KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2117Help
Entry
Rru_A2117         CDS       T00310                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00040  Pentose and glucuronate interconversions
rru00052  Galactose metabolism
rru00500  Starch and sucrose metabolism
rru00520  Amino sugar and nucleotide sugar metabolism
rru01100  Metabolic pathways
rru01130  Biosynthesis of antibiotics
Module
rru_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
rru_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rru_A2117
   00052 Galactose metabolism
    Rru_A2117
   00500 Starch and sucrose metabolism
    Rru_A2117
   00520 Amino sugar and nucleotide sugar metabolism
    Rru_A2117
Enzymes [BR:rru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rru_A2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 3835544
NCBI-ProteinID: YP_427204
UniProt: Q2RSH8
Position
complement(2457523..2458401)
Genome map
AA seq 292 aa AA seqDB search
MSRRVRKAVFPVAGMGTRFLPATKTMAKEMLPVVDKPLIQYAVEEAAAAGIDHFIFITGR
GKSVLMDHFDHMPELEALLKERGKTDVLENLLGSMPSPGKVFSTRQQQPLGLGHAVWCAR
AFIGDEPFAVLLPDDLVLADTPCIKQLIDAHAQTGGNVVAVEDVPRERTNKYGILDVVED
NGTLARAKGLVEKPDSDKAPSTLAIIGRYVLDPGIFDLLENQNRGAGGEIQLTDAMNAQI
KDVPFHGLRYEGARYDCGDKVGFLQANIAFALERPDMRDAVKAVLADFAKTI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgacgtgtgcgcaaggccgtatttccggttgccggaatgggaacgcgtttcctg
ccggcgaccaagaccatggcgaaggaaatgctgcccgtcgtcgataagccgctgatccaa
tacgcggtcgaagaagccgccgccgccggtatcgatcacttcatcttcatcaccggtcgc
ggcaaatcggtgctgatggaccatttcgaccatatgcccgagcttgaggccctgctcaag
gaacgcggcaagaccgatgttctggaaaacctgctgggctcgatgccctcgccgggcaag
gtgttctccacccgccagcagcagccccttggcctgggtcacgccgtgtggtgcgcccgc
gccttcatcggcgatgagcccttcgccgttctgctgcccgatgatctggtgctggccgat
acgccctgcatcaagcagctgatcgacgcccacgcgcagaccggcggcaatgtcgtcgcc
gtcgaggacgtgccgcgcgagcgcaccaacaaatacggcatcctcgacgtcgtcgaggac
aacggcaccctggcccgggccaagggtttggtcgaaaagcccgattccgacaaggcgccc
tcgaccctggcgattatcggccgctatgtgctcgatccgggcattttcgacctgctcgaa
aaccagaaccgcggtgccggtggcgagatccagttgaccgacgccatgaacgcccagatc
aaggacgttcccttccatggcctgcgctatgagggcgcgcgctatgactgcggcgacaag
gtgggcttcctgcaggccaatatcgccttcgccctggagcggcccgatatgcgcgacgcc
gtgaaggccgttctcgccgatttcgccaagaccatctga

DBGET integrated database retrieval system