KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2294Help
Entry
Rru_A2294         CDS       T00310                                 

Definition
(RefSeq) alpha amylase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00052  Galactose metabolism
rru00500  Starch and sucrose metabolism
rru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rru_A2294
   00500 Starch and sucrose metabolism
    Rru_A2294
Enzymes [BR:rru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Rru_A2294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C GHL5
Motif
Other DBs
NCBI-GeneID: 3835722
NCBI-ProteinID: YP_427381
UniProt: Q2RS01
Position
2653823..2655451
Genome map
AA seq 542 aa AA seqDB search
MSGQEWWKRAVIYQIYPRSFQDADGDGIGDLAGIAQRLDYLSWLGVDAIWISPFYTSPMK
DFGYDIQDYRDVDPIFGTLADFDALAARARALGLKLILDFVPNHTSDRHPWFLESRQSPA
SAKRDWYIWRDPAADGGPPTNWLAEFGGSAWEYDEASGQYYYHAFLKEQPDLNWRNPEVR
AAMYDAMRFWLERGVDGFRVDVMWHLIKDDQFRDNPPNPARPPNAGPANALIPLYTADRP
EVHDIVREMRAVVDAYPERVLIGEIWLPTDRLVTYYGHDLRGAHLPFNFQLIGAAWDAGV
IKEIVGDYEKALPRGGWPNWVMGNHDKGRIASRLGPRQARLAMLLLLTLRGTPTLYYGDE
IAMRDVPIPPDRVCDPYEKNVPGLGLGRDPQRTPMQWEDAPQAGFTRASRSWLPIAADAS
TVNVAAQRAAPASMLTLVHRLIALRKAEAALTIGDYGALDAPERVVMFLRRVPGRRLLIA
LNLGESAQSLSLPGDSRQATTLLSTDPERPLGDLAPAFTLGGGEGIVVLLADRETAPPSP
AA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtcaggaatggtggaaacgggccgttatctatcaaatctatccgcgcagtttc
caggatgccgatggcgatggcatcggcgatttggccggcatcgcccaacgcctggattac
ctgtcgtggctgggggtggacgcgatctggatctcgcccttctatacctcgccgatgaag
gatttcggctacgacattcaagactaccgcgatgtcgatccgatcttcggcaccctggcc
gatttcgacgccctggcggcgcgggcccgcgcgctggggctgaagctgatcttggatttc
gttcccaaccacacctctgatcggcatccgtggtttctcgaatcccgccaatcgcccgcc
agcgccaagcgcgactggtacatctggcgcgacccggccgccgatggcggcccgccgacc
aactggctggccgaattcggcggcagcgcctgggaatacgacgaagccagcggccagtat
tactaccacgccttcctcaaggagcagcccgacctcaattggcgcaatccagaagtccgc
gcggcgatgtatgacgccatgcgcttttggctcgagcgcggggtggatggcttccgcgtc
gatgtgatgtggcatctgatcaaggacgaccagttccgcgacaatccgcccaatccggcc
cgcccgcccaatgccggtccggccaatgccctgatcccgctctacaccgccgatcgcccc
gaagtgcacgacatcgtgcgcgagatgcgcgccgtggtcgacgcctatcccgaacgcgtg
ctgatcggcgagatctggctgcccaccgatcgcctggtcacctattacggccatgatctg
cgcggtgcccatctgccctttaatttccaattgatcggcgccgcctgggacgccggcgtc
atcaaagagatcgtcggcgactacgaaaaggccctgccccggggcggctggcccaattgg
gtgatgggcaatcacgacaagggccgcatcgccagccgcctgggcccccggcaggcccgg
ctggccatgctgctgctgctcaccctgcgcggcacccccaccctttactatggcgacgag
atcgccatgcgcgacgtgccgatcccccccgaccgggtctgcgatccttacgaaaagaac
gtgcccggcctgggtctggggcgcgacccccagcgcacgccgatgcaatgggaggacgct
ccccaggccggcttcacccgcgcttcccgatcctggttgccgatcgccgccgatgcctca
acggtcaatgtcgccgcccaacgcgcggcgccggcctcgatgctgaccctcgtccaccgc
ctgatcgccctgcgcaaagccgaagcggccctaactatcggcgattatggggcgctcgac
gctcccgagcgggtggtgatgttcctgcgccgcgttcccgggcgccgcctgctcatcgcc
ctcaatctgggggaaagcgcccaaagcctgagcctgcccggcgacagccgccaagccacc
accctgctgtccaccgacccggagcgcccgctgggcgatctggccccggccttcaccctt
ggcgggggcgagggcatcgtcgttttgctggccgaccgggaaacggcccccccgtccccg
gcggcgtaa

DBGET integrated database retrieval system