KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2673Help
Entry
Rru_A2673         CDS       T00310                                 

Gene name
rplF
Definition
(RefSeq) 50S ribosomal protein L6
  KO
K02933  large subunit ribosomal protein L6
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rru_A2673 (rplF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rru03011]
    Rru_A2673 (rplF)
Ribosome [BR:rru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rru_A2673 (rplF)
  Bacteria
    Rru_A2673 (rplF)
  Archaea
    Rru_A2673 (rplF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L6
Motif
Other DBs
NCBI-GeneID: 3836108
NCBI-ProteinID: YP_427757
UniProt: Q2RQX5
Position
complement(3100611..3101144)
Genome map
AA seq 177 aa AA seqDB search
MSRVGKYPVTVPAGVTITVKDNVVTAKGKLGEMTYTAAGEVETRLEDNLIWVKPLSETKH
ARQQWGTTRARINNLVRGVSEGFSRKLELVGVGYKAAAQGKVLKLSLGFSHDVDFPIPED
LKITTPAPNQIEISGVDKQRVGQIASEIRSYRSPEPYKGKGVKYAGEQILRKEGKKK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtgtaggtaaatatcccgtcaccgtccccgcgggcgtgaccatcaccgtcaaa
gacaatgtcgtgacggcgaagggcaagctgggcgagatgacttataccgccgctggcgag
gtggagacccggctcgaggacaacctcatctgggtcaagccgctgagcgaaaccaaacac
gctcgtcagcagtggggaaccacccgcgcccgcatcaacaatctggtgcgtggcgtcagc
gaaggcttctcgcgcaagctggaactggttggcgtcggctacaaggccgccgcccagggc
aaagtgctgaagctgtcgttggggttctcccatgacgtggactttccgatccccgaggat
ctgaagatcaccacgccggctcccaaccagattgagatttcgggcgtcgacaaacagcgc
gtcggccagatcgcctcggagattcgtagctaccgctcccccgagccctacaagggcaag
ggcgtgaagtacgccggcgagcaaattctccgcaaggaaggcaagaagaagtag

DBGET integrated database retrieval system