KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A2683Help
Entry
Rru_A2683         CDS       T00310                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rru_A2683 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rru03011]
    Rru_A2683 (rplV)
Ribosome [BR:rru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rru_A2683 (rplV)
  Bacteria
    Rru_A2683 (rplV)
  Archaea
    Rru_A2683 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 3836118
NCBI-ProteinID: YP_427767
UniProt: Q2RQW5
Position
complement(3104779..3105159)
Genome map
AA seq 126 aa AA seqDB search
MGKQATERRLADTEARAITKMIRTSPYKLNLVAESIRGKTAERALAELTFSKRRMADTVK
KTLQSAIANAENNHQLDVDQLIVSEAYVGKAMVLKRWRARARGRVGKILKPFSNLTIVVR
ERGETA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcaggcaaccgaacggcggctggccgacaccgaagcccgggccatcaccaag
atgatccggaccagcccctacaagctcaatctggtggccgagtcgatccgcggtaagacc
gcggagcgcgccctggcggagctcaccttctcgaagcgtcggatggccgatacggtcaag
aagacccttcagtccgcgatcgccaatgccgagaacaaccaccagctcgacgtcgatcag
ctgatcgtctccgaggcttatgtgggcaaggcgatggttttgaagcgttggcgggcccgg
gcccgtggccgcgtgggtaagatcctgaagcctttcagcaatctgaccatcgtggtgcgc
gagcggggggagacggcgtaa

DBGET integrated database retrieval system