KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3108Help
Entry
Rru_A3108         CDS       T00310                                 

Definition
(RefSeq) NAD-dependent epimerase/dehydratase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00052  Galactose metabolism
rru00520  Amino sugar and nucleotide sugar metabolism
rru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rru_A3108
   00520 Amino sugar and nucleotide sugar metabolism
    Rru_A3108
Enzymes [BR:rru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     Rru_A3108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 adh_short NmrA TrkA_N KR
Motif
Other DBs
NCBI-GeneID: 3836554
NCBI-ProteinID: YP_428190
UniProt: Q2RPP2
Position
3578642..3579628
Genome map
AA seq 328 aa AA seqDB search
MTALTEIDARHAAWRGRRVLVTGGAGFIGGHLCRRLVGLGAEVVVLDDLSTGRRDTVPRG
VRLIVGSVTDPALVRKALQGTEGCFHLAAIASVPLSVSALVDCHAVNQTGTLRLIEGLRD
NGGGRLVYASSSAVFGDPVALPLTMASPTRPISPYGVDKLACEAHARVAGGLYGLKSFGL
RFFNVYGEGQSDDSPYSGVIALFNRKLRDGQPITVFGDGSQSRDFVYVGDVIEGLLAAWN
EASVRGPVETVGTGCPTTVMDLARTIMEVHGRSVPVVHAPPREADIEHSYGKADFLARIL
PKPAVALRAGLARTLSISPPAATLAPTP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacagccctcacagagatcgatgcccgccatgccgcttggcgtggccggcgggtgctg
gtcaccggcggcgccggcttcatcggcggccatttgtgccgacgcctggttggcctgggg
gccgaggtcgtcgttcttgacgacctgagcaccggccgccgcgacacggtcccccggggg
gtccgcctgatcgtcggctcggtcaccgacccggctctggtgcgcaaggcgttgcaagga
acggaaggctgcttccaccttgccgccatcgcctcggtgccgctgtcggtcagcgccctg
gtcgattgccatgccgtcaaccagacgggaaccctgcgcctgatcgaaggtctgcgcgat
aacggcggcgggcggttggtctacgcctcgagttcggcggtctttggcgatccggtcgcc
ctgccgctgaccatggcctcgccaacgcggccgatctcgccctatggcgtcgacaagctg
gcctgtgaagcccacgcccgggtggccggcgggctttatgggctgaaaagcttcggcctg
cgcttcttcaacgtttatggcgaggggcaatccgacgattcgccctatagcggcgtcatc
gccctcttcaatcgcaagctccgcgacggtcagccgatcaccgtctttggtgacggctcc
caaagccgcgacttcgtctatgtcggcgatgtcatcgaggggctgctcgccgcctggaac
gaggccagcgtccgcggaccggtggaaaccgtcggcaccggctgcccgaccaccgtgatg
gatctggcccggacgatcatggaggtccacggccgcagcgttcccgtcgttcacgccccg
ccgcgcgaagccgatatcgaacattcctacggcaaggccgatttcctggcccgcatcctg
cccaagccggcggtggctttgcgcgccgggttggcgcggacgctgtcgatctctcccccc
gccgcaaccttggccccaactccatag

DBGET integrated database retrieval system