KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A3640Help
Entry
Rru_A3640         CDS       T00310                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rru_A3640
Enzymes [BR:rru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Rru_A3640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 3837096
NCBI-ProteinID: YP_428721
UniProt: Q2RN61
Position
complement(4181442..4182047)
Genome map
AA seq 201 aa AA seqDB search
MAMSRRLVESPLVVASHNAGKVREIAELIAPFGLEARSAASLDLPEPEETGSSFVENALL
KAHAAARATGLPALADDSGLAVSALGGDPGIYSARWAGPTKDFALAMATINHLLGDNPDR
SAHFVCALALAWPDGHAETFEGRVDGVLVWPPRGDQGFGYDPMFLGEGAAETFGEMDPAA
KHAISHRARAFALLVAACLGG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtcgcgtcgccttgttgaaagtccgctggtcgttgccagccataacgccgga
aaggtccgcgagatcgccgagttgatcgcgcccttcggcctggaagcgcgatcggcggcc
agcctcgatctgcccgaacccgaggaaaccggatcgagcttcgtcgaaaacgccctgctc
aaggcccatgcggcggcccgggccaccggtctgcccgccctggccgatgattccgggctg
gccgtcagcgccctgggcggcgatcccggcatctactcggcgcgatgggccggtccgacc
aaggacttcgccttggccatggcgacgattaatcatctcctaggagacaatcccgaccgc
agcgcccatttcgtctgcgccctcgccctggcttggcccgatggtcatgccgagaccttc
gagggccgggtcgacggcgtgctggtctggccaccgcgcggcgatcagggctttggctat
gatccgatgttcctgggcgagggcgcggccgaaacctttggcgagatggacccggcggcc
aaacacgccatcagccaccgcgcccgcgccttcgccttgctggtggcggcatgcctgggc
ggctga

DBGET integrated database retrieval system