KEGG   Rathayibacter rathayi: C1O28_02090Help
Entry
C1O28_02090       CDS       T05845                                 

Definition
(GenBank) ADP-forming succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rry  Rathayibacter rathayi
Pathway
rry00020  Citrate cycle (TCA cycle)
rry00640  Propanoate metabolism
rry00660  C5-Branched dibasic acid metabolism
rry01100  Metabolic pathways
rry01110  Biosynthesis of secondary metabolites
rry01120  Microbial metabolism in diverse environments
rry01130  Biosynthesis of antibiotics
rry01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C1O28_02090
   00640 Propanoate metabolism
    C1O28_02090
   00660 C5-Branched dibasic acid metabolism
    C1O28_02090
Enzymes [BR:rry01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     C1O28_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AZZ48135
Position
411042..412205
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQARDLFEKYGVPVLPGIVADTPEEVRAAAEKLGGVTVVKAQVKIGGRGKAGGVK
VAKTPEDAFAAAQSILGLDIKGHVVKRVMVAGGARIDREFYFSVLLDRANRSYLSLTSYE
GGMEIEQLAVERPDALARVEVVPGQGIDAAKAEEIARAAKFPEELIAKVAPVLVKLYDVY
TGEDATLVEVNPLVLTEEGDIVALDGKVSLDENAGFRHADHAALEDKDATDPLEAKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHNGVKPANFLDIGGGASAQVMANGLD
VILGDEQVKSVFVNVFGGITACDAVANGILQALEILGDSATKPLVVRLDGNKVEEGRAIL
QAAAHPLITLAATMDEGADKAAALAAA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcttcgaataccaggcccgtgatctgttcgagaagtacggcgtccccgtactc
ccgggcatcgtcgccgacacgccggaggaggtgcgcgccgcagcggagaagctgggcggc
gtcaccgtcgtcaaggcgcaggtgaagatcggcggccgcggtaaggcgggcggcgtgaag
gtcgcgaagacccccgaggacgctttcgccgcggcgcagtcgattctcggcctggacatc
aagggccacgtagtgaagcgcgtcatggtcgccggcggtgcgcgcatcgaccgcgagttc
tacttctcggtgctgctcgaccgggccaaccgctcctacctctcgctcacctcctacgag
ggcgggatggagatcgagcagctcgccgtcgagcgcccggacgcgctcgcacgcgtcgag
gtcgtccccggccagggcatcgatgcggccaaggccgaggagatcgcccgcgcggcgaag
ttcccggaggaactgatcgccaaggtcgcacccgtcctggtgaagctgtacgacgtctac
accggcgaggacgccacgctcgtcgaggtgaacccgctcgtgctgaccgaggagggcgac
atcgtcgcgctcgacggcaaggtctcgctcgacgagaacgccggcttccgccacgccgat
cacgccgcgctcgaggacaaggacgccaccgacccgctcgaggctaaggccaaggagaac
gacctcaactacgtgaagcttgacggcgaggtcgggatcatcggcaacggcgccggcctc
gtcatgtcgaccctcgacgtcgtcgcctacgccggagagaagcacaacggcgtgaagccg
gcaaacttcctcgacatcggcggcggagcctccgcccaggtgatggcgaacggcctcgac
gtgatccttggcgacgagcaggtcaagagcgtcttcgtgaacgtcttcggtggcatcacc
gcgtgcgacgcggtcgccaacggcatcctccaggcgctcgagatcctcggcgattcggca
acgaagccgctcgtcgtccgcctggacggcaacaaggtcgaggagggccgcgcgatcctc
caggccgctgcccaccccctcatcacgctcgccgcgacgatggacgagggcgcggacaag
gccgccgcactcgccgccgcgtaa

DBGET integrated database retrieval system