KEGG   Rathayibacter rathayi: C1O28_09425Help
Entry
C1O28_09425       CDS       T05845                                 

Definition
(GenBank) NADP-dependent phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
rry  Rathayibacter rathayi
Pathway
rry00030  Pentose phosphate pathway
rry00480  Glutathione metabolism
rry01100  Metabolic pathways
rry01110  Biosynthesis of secondary metabolites
rry01120  Microbial metabolism in diverse environments
rry01130  Biosynthesis of antibiotics
rry01200  Carbon metabolism
Module
rry_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rry_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:rry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C1O28_09425
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C1O28_09425
Enzymes [BR:rry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     C1O28_09425
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     C1O28_09425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 3HCDH_N NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: AZZ49390
Position
1975777..1977234
Genome map
AA seq 485 aa AA seqDB search
MSDKPTATANIGVVGLAVMGSNLARNLASREGNTVAVFNRSYGRTETLIAEHPEAGFVAS
ETIEDFAASLATPRTAIIMVQAGRGTDAVIEQLTRVFEPGDIIVDGGNALFTDTIRREKA
VRETGIHFVGTGISGGEEGALKGPSIMPGGSVESYRTLGPILSSIAAVAEGEPCVTHIGT
DGAGHFVKMIHNGIEYADMQLIAEAYDLLRTVGGHEPAAIAEVFDAWNKGDLESYLIEIT
AEVLRQVDADTGKPFLDIVLDQAGSKGTGVWTVQNALDLGVPVGGIAEAVFARAVSSHPE
QREAVQARITSRPTPVEKYEGFEDDVRAALYASKVVAYSQGFDAIIAGAEKYGWEIDKGA
VATIWRAGCIIRAQFLNRIVDAYDENAGITTLLEDPYFAEAVANGEAAWRRIVSTAALSG
VPIPGFGAALSYYDSLASKRLPAALVQGQRDFFGAHTYQRVDKEGTFHTLWSGDRTEVEQ
DPSTH
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacaagcccaccgccacagccaacatcggagtcgtcggtctggcggtgatgggc
tcgaacctcgcgcgcaacctcgccagccgcgagggcaacaccgtcgcggtcttcaaccgc
tcctacggccgcacagagaccctcatcgccgagcacccggaggcgggcttcgtcgcctcg
gagacaatcgaggacttcgccgcctccctcgccactccgcgcaccgcgatcatcatggtc
caggccggccgcggcaccgacgccgtgatcgagcagttgactcgggtcttcgagcccggc
gacatcatcgtcgacggcggcaacgctctcttcacggacaccatccgccgcgagaaggcc
gtccgcgaaaccggcatccacttcgtcggcaccggcatctccggcggcgaggagggcgcg
ctcaagggcccctcgatcatgcccggcggctcggtggagtcgtaccggaccctcgggccg
atcctctcctcgatcgccgcggtcgctgagggtgagccgtgcgtcacccacatcggcacc
gatggcgccggccacttcgtcaagatgatccacaacggcatcgaatacgcggacatgcag
ctcatcgccgaggcatatgacctgctacgcaccgtcggtggtcacgaacccgccgccatt
gccgaggtcttcgacgcctggaacaagggcgacctcgagtcgtacctcatcgaaatcacc
gccgaggtgcttcgccaggtcgacgccgacaccgggaagcccttcctcgacatcgtcctc
gaccaggccggctccaagggcaccggtgtctggaccgtgcagaacgcgctcgacctcggc
gtccccgtcggcggcatcgccgaggccgtcttcgctcgcgccgtctcctcgcacccggag
cagcgcgaagccgtccaggcgcgcatcacgtcgcgtccgaccccggtcgagaagtacgag
ggcttcgaggacgacgtgcgcgccgcgctctacgcctccaaggtcgtggcctactcgcag
ggcttcgacgcgatcatcgcgggcgccgagaagtacggctgggagattgacaagggcgcc
gtcgccacaatctggcgcgcgggctgcattatccgcgcgcagttcctcaaccggatcgtg
gacgcctacgacgagaacgccggcatcacgaccctgctcgaggacccgtacttcgccgag
gctgtcgcgaacggcgaggcagcctggcgccgcatcgtctcgaccgccgcgctctcgggt
gtgccgatccccggcttcggcgccgcgctgtcctactacgactcgctcgcctcgaagcgc
ctcccggcggctctcgtccagggccagcgtgactttttcggcgcgcacacctaccagcgg
gtcgacaaggagggcaccttccacacgctgtggtcgggcgatcgcaccgaggtcgagcag
gatccctccacgcactga

DBGET integrated database retrieval system