KEGG   Rathayibacter rathayi: C1O28_09480Help
Entry
C1O28_09480       CDS       T05845                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rry  Rathayibacter rathayi
Pathway
rry00450  Selenocompound metabolism
rry00970  Aminoacyl-tRNA biosynthesis
rry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rry00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C1O28_09480
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C1O28_09480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rry01007]
    C1O28_09480
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rry03016]
    C1O28_09480
Enzymes [BR:rry01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C1O28_09480
Amino acid related enzymes [BR:rry01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C1O28_09480
Transfer RNA biogenesis [BR:rry03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C1O28_09480
 Prokaryotic type
   Other AARSs
    C1O28_09480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AZZ50498
Position
complement(1988747..1990324)
Genome map
AA seq 525 aa AA seqDB search
MSDGASFFLTTPIFYVNDVPHIGHAYTEVAADVLTRWHRQAGDDTWLLTGTDEHGQKILR
TATANGTTPQEWADRLVKSAWQPLLETIDIANDDFIRTTEARHEVNVQKFLHKLYDAGAI
YTGEYEGYYCVGCEEYKQLSDLEEGTGDYTGQYVCTIHSKPVELLKEKNYFFSMSEYTER
LLALYEERPDFVQPESARNEVVSFVRQGLADLSISRSSFDWGVKVPWDDSHVVYVWFDAL
LNYITAVGYGQDEAEFQRRWPATHIVGKDILRFHAVIWPAMLMAAGLEVPKQIFGHGWLL
VGGEKMSKSKLTGIAPEQITDTFGSDAFRYYFLRAITFGQDGSFSWEDLSARYQSELANG
FGNLASRVIAMLHRYYDGVVPEPGTLTEAEKRIQRTVAEAATSADRSIDALAIHDAITAV
WSIVEELNGYITEQEPWALAKREERERLGTVLYTATEGLRALAVLLSPVVPRATTALWEA
LGVTESLGALTAQPIRAAGRWGILPVGTTVGTLEALFPRIEAPVS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacggcgcctccttttttctcacgactccgatcttctacgtgaacgacgtcccg
cacatcgggcacgcatacaccgaggtcgccgccgacgtgctcacccgctggcaccgccag
gcgggagatgacacctggctgctgaccggcaccgacgagcacggccagaagattttgcgg
actgctaccgccaacgggaccactccccaggagtgggccgaccgcctcgtgaagtccgcg
tggcagccgctgctcgagacgattgatatcgccaatgacgacttcatccgcaccacggag
gcgcggcacgaggtcaacgttcagaagttcttgcacaagctctacgacgcgggcgcgatc
tacaccggcgagtacgagggctattactgcgtgggctgcgaggagtacaagcagctgtcc
gacctcgaggagggcaccggcgactacaccgggcagtacgtctgcacgatccactcgaag
ccggtcgagctgctgaaggagaagaactacttcttctcgatgagcgagtacaccgagcgg
ctgctcgcgctctatgaggagcggcccgacttcgtgcagcccgagtcggcgcgcaacgag
gtcgtcagcttcgtccgccagggcctggccgacctgtcgatctcgcgctccagcttcgac
tggggcgtgaaggtcccgtgggacgactcacacgtcgtctacgtgtggttcgacgcgctg
ctcaactacatcaccgcggtcggctacggccaggacgaggcggagttccagcgccggtgg
ccggcgacccacatcgtcggcaaggacatcctgcgcttccacgcggtgatctggcccgcc
atgctcatggccgccgggctcgaggtgccgaagcagatcttcggccacggctggctgctg
gtcggcggcgagaagatgtcgaagtcgaaactcaccggaatcgcgcccgagcagatcacc
gacaccttcggctccgacgcgttccgctactacttcctgcgtgccatcactttcggacag
gatggctcgttctcgtgggaggacctgtcggcgcggtaccagtccgagctcgcgaacggc
ttcggcaacctcgcctcccgggtgatcgcgatgctgcaccgctactacgacggcgtcgta
cccgagcccgggacactcaccgaggcggagaagcgcatccagcgcactgtcgcggaggcc
gccacctccgcggaccgctcgatcgacgctctcgcgatccacgacgcgatcaccgccgtc
tggagcatcgtcgaggagctcaacggctacatcaccgagcaggagccgtgggcgctggcc
aagcgcgaggagcgcgagcgcctcggcacggtgctctacacggcgacggaggggctgcgt
gccctggccgtgctgctctcgccggtcgtgccgcgggcgacgacggcgctctgggaggcg
ctgggagtgacggagtcgctgggcgccctcaccgcgcagccgatccgcgcggcgggccgc
tggggaatcctgcccgtcggcaccaccgtcggcactctcgaggcgctcttcccgcgcatt
gaggcaccggtgtcctga

DBGET integrated database retrieval system