KEGG   Rathayibacter rathayi: C1O28_09845Help
Entry
C1O28_09845       CDS       T05845                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
rry  Rathayibacter rathayi
Pathway
rry00020  Citrate cycle (TCA cycle)
rry00620  Pyruvate metabolism
rry01100  Metabolic pathways
rry01110  Biosynthesis of secondary metabolites
rry01120  Microbial metabolism in diverse environments
rry01130  Biosynthesis of antibiotics
rry01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C1O28_09845
   00620 Pyruvate metabolism
    C1O28_09845
Enzymes [BR:rry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     C1O28_09845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AZZ49459
Position
complement(2067027..2068574)
Genome map
AA seq 515 aa AA seqDB search
MGATALSPPWRARASVNSTLVNSSEPVDVALIGGGIMSATLGALITQLQPDWTIAAYERL
GDVAQESSNPWNNAGTGHAALCELNYMPEAADGSVDAAKAIQINEQFQISRQFWSSLVES
GDIREPSSFINPAPHMTFVHGDANVEYLRKRYEALKDQPLFAGIEFTESITTIHEWAPLL
MEQRPAGGGPYAATRVPAGTDVDFGSLTHQLFDHVVAHGGTLDTGREVTDITRQKDGTWR
LDLKQVVGGTPQRVSARFVFVGAGGGALHLLQKSGIPEIKGFGGFPISGQFLRTDNPELV
ARHKAKVYGKAAVGAPPMSVPHLDARVVDGESSLLFGPYAGFTPKFLKRGSWLDLPLSIR
PHNIGPMLAVARDNLDLMKYLIGEVLAGRGKKMKALREFLPTARDEDWYLITAGQRVQVM
KKDEKKGGVLQFGTEVITGAEGTIAGLLGASPGASTAVPIMLDIVQKCFPDRMTAWEPRI
RALVPSYGSTLNDAPEKAERTVSTTAETLELAASV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgaccgccctctccccaccgtggcgcgctcgggcgagcgtaaactcgactctc
gtgaactcctcggaaccggtcgacgttgccctcatcggtgggggcattatgagcgccact
ctcggcgcactgatcacccagctgcagcccgactggacgatcgccgcctacgagcgcctc
ggcgacgttgcacaggagtcgtcgaacccgtggaacaacgcgggcaccggtcacgccgcc
ctctgcgagctgaactacatgcccgaggcggccgacggctcggtggacgcggcgaaggcc
attcagatcaacgagcagttccagatctcgcgtcagttctggtcgagcctggtcgaatca
ggtgacatccgcgagccgtccagcttcatcaacccggcgccgcatatgaccttcgtgcac
ggcgacgcgaacgtcgagtacctgcgcaagcgctatgaagccctgaaggaccagcctctc
tttgccggcattgagttcaccgagagcatcacgacgatccacgagtgggcgcccctgctg
atggagcagcggccggcgggcggtggcccctacgccgcgacccgcgtgccggccggaacc
gatgtcgacttcggctcgctgacgcaccagctgttcgaccacgtcgtcgcccacggcggc
accctcgacacgggtcgcgaggtcaccgacatcacccgacagaaggacggcacctggcgc
ctcgatctcaagcaggtcgtgggcggaacgccccagcgagtgagcgcccgctttgtcttc
gtcggcgcaggcggcggcgcgctgcaccttttgcaaaagtcggggatccccgagatcaag
ggctttggaggcttccccatctcggggcaattcctccgcaccgacaacccagagctggtc
gcccggcacaaggcgaaggtgtacggcaaggccgcggtcggtgcgccaccgatgtcagtg
ccgcacctcgacgcccgcgtcgtcgacggcgagtcctcactcctcttcggcccgtatgcc
ggcttcacgcccaagttcctcaagcgtgggtcgtggctcgacctgccgctctcgatccgc
ccccacaacatcggcccgatgctcgcggttgctcgcgacaacctcgacctgatgaagtac
ctcatcggcgaggtgctcgccggccgcggcaagaagatgaaggcgttgcgcgagttcttg
ccgaccgcccgcgatgaggactggtacctgattacggccgggcagcgcgttcaggtgatg
aagaaggacgagaagaagggcggagtgctgcagttcgggaccgaggtcatcactggcgca
gaggggaccatcgccggcctcctcggcgcctcgcccggagcatcgacggcggtgccgatc
atgctcgacatcgtgcagaagtgcttccccgaccggatgacggcctgggagccccggatc
cgcgcactggtgccgagctacggctccaccctcaatgacgcaccggagaaggccgagcga
accgtcagcacgaccgccgaaacgctggaactcgccgcgtcggtgtga

DBGET integrated database retrieval system