KEGG   Rathayibacter rathayi: C1O28_13980Help
Entry
C1O28_13980       CDS       T05845                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rry  Rathayibacter rathayi
Brite
KEGG Orthology (KO) [BR:rry00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C1O28_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 ABC_export
Motif
Other DBs
NCBI-ProteinID: AZZ50161
UniProt: A0A2S5XZB3
Position
2904569..2905783
Genome map
AA seq 404 aa AA seqDB search
MDPFLLLALVVVTALAFDFTNGFHDTANAMATSIATGALKPRTAVALSASLNLVGAFLSI
EVALTVTNAVVKIQDSSGAPDPALLEGGGSALLLIVLAGLIGGIVWNLLTWLLGLPSSSS
HALFGGLIGSALAGLGLKGVNWAGDGTRLDGVVGKVILPALMSPVLAGAVAAVGTWLVFR
VIGNLAEKGLHRGFRIGQIGSASLVSLAHGTNDAQKTMGVITLALIAAGGWSDTGSVPFW
VKLSCALAISLGTYIGGWRIIRTVGKGLVEINTPQGMAAESASAAVILASSHLGFALSTT
HVATGSILGSGVGRPGAQVRWRVALRMVIAWVITLPAAALVGAVMWWIGHLVGGAAGGLL
MAAVLVAVASLIYIRSRRDSIGAHNVNDEWQDAAARPAPETAGV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggatcccttcctcctgctcgcgctcgtcgtcgtcacggccctcgccttcgacttcacc
aacggtttccatgacacggcgaacgcgatggccacgtccatcgcgaccggtgccctgaaa
ccccgcaccgcggtcgccctctcggcgtcgctgaacctggtgggggcgttcctcagcatc
gaggtggcgctgaccgtcaccaacgcggtcgtgaagatccaggactcctcgggcgcaccc
gacccggcgctgctggagggcggcggatccgctctgctgctgatcgtgctggccggcctg
atcggtggcatcgtctggaacctgctgacctggctgctcggcctgccctcgagttcgtcg
cacgccctcttcggcggcctgatcggctccgccctcgcgggcctgggcctcaagggcgtg
aactgggccggtgacggcaccaggcttgacggcgtcgtcggcaaggtgatcctcccggcg
ttgatgtcgcccgtgctcgccggagcagttgcggcggtcggcacctggctcgtcttccgc
gtgatcgggaacctcgccgagaagggcctgcaccgtggattccgcatcggccagatcggc
agcgcctccctcgtctcgctcgcgcacggcaccaacgatgcacagaagacgatgggagtg
atcacgctggcgctgatcgcggccggcggctggagtgacaccgggtcggttccgttctgg
gtcaagctcagctgcgcactggccatctcgctcggcacctacatcggcggctggcggatc
atccgcaccgtcggcaagggcctggtcgagatcaacactccgcagggcatggccgccgag
agcgcctccgccgcagtcatcctcgcctccagccacctcggcttcgccctctcgaccacg
cacgtcgcgaccggctcgatcctcggctccggagtcggccgccccggcgcccaggtccgc
tggcgagtggcgctgcgcatggtgatcgcgtgggtcatcaccctgccggccgccgccctg
gtcggcgccgtgatgtggtggatcggccacctcgtcggtggcgcggccggtggcctgctg
atggccgcggtcctcgtcgccgtcgcctccctcatctacatccgctcgcgccgcgacagc
atcggcgcgcacaacgtcaacgacgagtggcaggacgcggcggcacgccccgcgcccgag
accgccggcgtctga

DBGET integrated database retrieval system