KEGG   Rhodococcus ruber: CS378_04625Help
Entry
CS378_04625       CDS       T05142                                 

Definition
(GenBank) poly-beta-hydroxybutyrate polymerase
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00650  Butanoate metabolism
rrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CS378_04625
Enzymes [BR:rrz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     CS378_04625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhaC_N Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: ATQ28084
UniProt: Q53049
Position
1040313..1042001
Genome map
AA seq 562 aa AA seqDB search
MLDHVHKKLKSTLDPIGWGPAVTSVAGRAVRNPQAVTAATAEYAGRLAKIPAAATRVFNA
NDPDAPMPVDPRDRRFSDTAWQENPAYFSLLQSYLATRAYVEELTEAGSGDPLQDGKARQ
FANLMFDALAPSNFLWNPGVLTRAFETGGASLLRGARYAAHDILNRGGLPLKVDSDAFTV
GENLAATPGKVVFRNDLIELIQYAPQTEQVHAVPILAAPPWINKYYILDLAPGRSLAEWA
VQHGRTVFMISYRNPDESMRHITMDDYYVDGIATALDVVEEITGSPKIEVLSICLGGAMA
AMAAARAFAVGDKRVSAFTMLNTLLDYSQVGELGLLTDPATLDLVEFRMRQQGFLSGKEM
AGSFDMIRAKDLVFNYWVSRWMKGEKPAAFDILAWNEDSTSMPAEMHSHYLRSLYGRNEL
AEGLYVLDGQPLNLHDIACDTYVVGAINDHIVPWTSSYQAVNLLGGDVRYVLTNGGHVAG
AVNPPGKRVWFKAVGAPDAESGTPLPADPQVWDEAATRYEHSWWEDWTAWSNKRAGELVA
PPAMGSTAHPPLEDAPGTYVFS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgaccacgtgcacaagaagttgaagtcgaccctggacccgatcggctggggtccc
gcagtgacgtcggtggccggacgcgcggtccgcaaccctcaggccgtcaccgccgcgacg
gcggagtacgcgggccggctggcgaagatcccggccgcggccacccgcgtgttcaacgcg
aacgatcccgacgcaccgatgccggtcgacccgcgggaccgccgcttctccgacaccgcg
tggcaggagaaccccgcgtacttctcgctcctgcagagctacctggccacgcgggcctac
gtcgaggaactcaccgaggccggctccggcgatccgctgcaggacggtaaggcacgccag
ttcgcgaacctgatgttcgacgcgttggcgccgtcgaacttcctgtggaatcccggtgtg
ctcacccgcgccttcgagaccggcggggcgagcctgctgcgcggcgcccgctacgccgcg
cacgacatcctcaaccgcggcggcctgccgttgaaggtggattcggacgcgttcaccgtc
ggcgagaacctcgcggccacacccggcaaggtggtcttccgcaacgacctgatcgagctg
atccagtacgcgccgcagaccgagcaggtgcacgcggtgccgatcctggccgcaccgccc
tggatcaacaagtactacatcctcgacctcgcgcccggccggagcctcgccgaatgggcg
gtccagcacggccgaaccgtgttcatgatctcgtaccggaacccggacgagtcgatgcgg
cacatcacgatggacgactactacgtcgacggcatcgccactgcgctggacgtggtcgag
gagatcaccggctcgccgaagatcgaggtgctctccatctgcctcggcggcgcgatggcc
gcgatggccgccgcgcgcgcgttcgccgtcggcgacaagcgcgtgagcgccttcacgatg
ctcaacacgctgctcgactacagccaggtcggggaactgggtctgctgaccgacccggcg
acgctggacctcgtcgagttccggatgcggcagcagggcttcctgtccggcaaggagatg
gccggcagcttcgacatgatccgcgcgaaggacctcgtcttcaactactgggtctcgcgg
tggatgaagggcgagaagccggcggccttcgacatcctcgcgtggaacgaggacagcacg
agcatgcccgcggagatgcactcgcactacctccggtcgctctacggccgcaacgagctc
gccgagggcctctacgtgctcgacggacagccgctgaacctgcacgacatcgcgtgtgac
acctatgtcgtcggcgcgatcaacgaccacatcgtgccctggacgtcgtcgtaccaggcg
gtgaacctgctcgggggcgacgtgcgctacgtgctcaccaacggcgggcacgtcgccggt
gcggtgaaccccccgggcaagcgggtgtggttcaaggccgtcggcgcgccggacgccgag
tccggcacccccctgcccgcggatccgcaggtctgggacgaggccgccacccgctacgag
cactcgtggtgggaggactggacggcgtggtcgaacaagcgcgccggggaactggtggcg
ccgccggccatggggagtaccgcccatcccccgctcgaggatgctccgggtacgtacgtc
ttcagctga

KEGG   Rhodococcus ruber: CS378_11100Help
Entry
CS378_11100       CDS       T05142                                 

Definition
(GenBank) poly(3-hydroxyalkanoate) polymerase
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00650  Butanoate metabolism
rrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CS378_11100
Enzymes [BR:rrz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     CS378_11100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhaC_N Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: ATQ29232
Position
complement(2492153..2493862)
Genome map
AA seq 569 aa AA seqDB search
MTTTVTTTEPVHRSDEPAAPVDLLLAGSARGLARRMLPDRGWARLAGGLAARPGTLAHRG
GTLARELAAVAAGRADRAPAKGDKRFADPAWQHNPWLRRSMQAYLATADTAYALLADAGL
DWRDTERMRFVLDNLVEGLAPSNNPVLNPLGWKALIDTGGLSALRGARAFACDMATKPRV
PAMVEPGAYTLGETVAVTPGAVVLRTPVLELIQYAPHTDTVHEVPLLMVPPVINKYYITD
IAPGRSMIEYFVAQGQQVFTISWRNPHAEHRDWGLDTYVTAIVDAMDAVQAITGTGRTHL
QGSCSGGILAATTAAYLAATGHGDRVAGLTLAVTVLDQARAGFAAAALDERTAATAIERS
QSRGYLDGDELAEVFAWLRPTDLVWRYWVNNYLQGRPPAPFDVLHWNADTTRMAAGLHRD
LVRIGVTNALAAPGTMELSGTPIDLGAVTADAYVIGGIADHISPWQGCYRSAALLGGADT
RFVLSTSGHVAALVNPPGNPKASFRVGTVDADTPEQWLDRAEVTRDSWWPDYTAWLAARS
GPTVPAPTTVGGAAHSPLDAAPGTYVHHS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccgtcaccaccaccgagcccgtgcaccgttccgacgaacccgccgcgccg
gtggacctgctgctggccggctcggcccgcggcctggcccgccggatgctgcccgatcga
ggctgggcccggctcgcgggcggactggccgcgcgccccggcacgctcgcgcaccgcggc
ggaaccctggccagggaactcgccgccgtcgccgccggccgcgccgaccgcgcacccgcc
aagggcgacaagcgattcgccgacccggcatggcagcacaacccgtggttgcgtcgcagc
atgcaggcctacctcgccaccgccgacaccgcctatgccctgctcgccgacgccggcctg
gactggcgcgacaccgaacggatgcggttcgtgctcgacaacctcgtcgagggtctcgcg
ccgagcaacaatccggtactcaacccgctcggatggaaggcgctcatcgacaccggcgga
ctgtccgcgctgcgcggggcgcgtgcattcgcctgcgacatggccaccaagccgcgggtg
cccgccatggtcgaacccggtgcctacaccctcggcgagaccgtcgcggtgacacccggg
gcggtggtgctgcgaaccccggtactcgagctgatccagtatgcgccgcacaccgacacc
gtgcacgaggtgccgctgttgatggtgcccccggtgatcaacaagtactacatcaccgac
atcgccccaggccgcagcatgatcgagtacttcgtcgcccagggccagcaggtgttcacc
atctcctggcgcaacccccatgccgaacaccgggactggggcctcgacacgtacgtcacg
gcgatcgtcgatgcgatggacgccgtccaggcgatcaccgggaccggccgcacgcacctg
caaggcagctgttcgggcgggatcctggccgcgacgaccgccgcgtacctggccgctacc
ggacacggcgaccgggttgccgggctgaccctggcggtgaccgtgctcgaccaggcgcgg
gccgggttcgccgccgccgccctcgacgaacgcaccgccgcgactgcgatcgaacgctcg
cagtcgaggggctacctggacggggacgagctggccgaggtgttcgcctggctgcgcccg
accgacctggtgtggcgctactgggtcaacaattacctgcagggccgcccgcccgcgccg
ttcgacgtgctgcactggaacgccgacaccacccgcatggccgccggcctgcaccgcgac
ctggtccgcatcggcgtcaccaacgcgctggccgcccccggcacgatggagctgtcgggt
accccgatcgatctcggcgcggtcaccgccgacgcgtacgtgatcggcgggatcgccgac
cacatctcgccgtggcaaggctgctaccgcagcgccgccctgctgggcggtgccgacacc
cggttcgtgctctccaccagcgggcacgtcgccgcgctggtcaacccccctggaaacccc
aaggcgtccttccgggtcgggaccgtcgacgcggacaccccggagcagtggctcgaccgc
gcggaggtcacccgagactcgtggtggcccgactacaccgcctggctcgctgcgcgcagc
ggccccaccgttcctgcccccaccaccgtcggcggtgccgcccactccccgctcgacgcc
gcaccgggcacctacgttcaccacagctga

KEGG   Rhodococcus ruber: CS378_11610Help
Entry
CS378_11610       CDS       T05142                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00650  Butanoate metabolism
rrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CS378_11610
Enzymes [BR:rrz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     CS378_11610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DLH DUF2048 PHB_depo_C Abhydrolase_5 Esterase DUF2974 PhaC_N
Motif
Other DBs
NCBI-ProteinID: ATQ29316
Position
complement(2602475..2603470)
Genome map
AA seq 331 aa AA seqDB search
MGDDWTTPHSTPKDVVWQQGDVKLWRYHSEKVSKSPPLLLFIGLVSRSSIFDLHERVSLV
RNLRDEGFDVFVLDWGTPGPGDADNTLETYVCRYLPRAVRAVLRASGASDLTVLGYCMGG
NLALLAAASQPKLPIRNLITMATAVDFSQLPAQFGALRDPNQDLEAFIDGETGCISPNLI
EAAFRVRKPTAAAAQYANLLENLFDDTYVGGHQAIARWTSDHIPLPGGVARQVVESWLRQ
NSFVNGTLRVAGRPATLESIRCPVLSIVATRDEIVPLAAAQPMGALLGSSDFEMLKLDAG
HIGLVIGRGARKVVLPRILAWLIEHSEARES
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgattggaccacgccgcactcgacaccgaaagatgttgtctggcagcagggt
gatgtcaagctgtggcggtaccatagcgaaaaggtgtccaaatcaccgcccctgctgctc
ttcatcggcctagtctctcgcagttcaatcttcgatctgcacgagagggtcagtcttgtt
cggaatctgcgcgacgaaggattcgatgtgttcgtcctggattggggtaccccgggtccg
ggcgacgcagacaataccctggagacgtacgtctgccggtatctcccccgtgcggtccgc
gctgttctgcgagcctcaggggcttcggatctgactgttctcgggtactgcatgggcggc
aacctcgcactgttggctgcggcgtcgcaaccgaagcttcccatccgcaatctcatcacg
atggcgacggccgtcgacttcagtcagctgccggcgcaattcggtgctctgcgcgacccg
aatcaagatctggaggcgttcatcgacggtgaaaccggatgcatttcaccgaatctgatt
gaagctgctttccgggttcgcaaaccaacggcggctgccgcgcagtatgccaacttgctg
gagaacctgttcgacgacacttacgtcggagggcaccaagcgatcgcgaggtggacgagt
gatcatataccgctgcccggaggcgtagcgcggcaggttgtggaaagctggctacgtcaa
aattcgttcgtgaacgggacattgcgcgtagcaggtcgacccgcaaccctcgaatcgatc
agatgcccggtactgagcatcgttgcgacacgcgacgagatcgttcctctcgctgcagca
caaccgatgggcgcactcctgggttcgtcggatttcgagatgctgaaacttgatgccggc
catatcggtctagtgattgggcgcggggcgcggaaggtagtgctgccaaggattcttgcg
tggctcatcgagcacagcgaggcaagggagagttaa

KEGG   Rhodococcus ruber: CS378_12085Help
Entry
CS378_12085       CDS       T05142                                 

Definition
(GenBank) poly-beta-hydroxybutyrate polymerase
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00650  Butanoate metabolism
rrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CS378_12085
Enzymes [BR:rrz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     CS378_12085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhaC_N Abhydrolase_1 MFS_4 Thioesterase
Motif
Other DBs
NCBI-ProteinID: ATQ29386
Position
2699376..2701058
Genome map
AA seq 560 aa AA seqDB search
MTQTRSVIGDSVEESIGGGEDVAPPRLGAAVGALADVFGHGRTVARHGAAFGKELAKIAA
GRSTVAPAEGNRRFADPAWSTHPAYRRLEQTYLAATDAVDGVVADVGRGIDPRRAAEAKF
AADILTAALAPTNYLWTNPAALKEAFDTAGLSLVRGTKHFVSDVVENRGMPSMVRRGAFT
VGTDLAVTPGAVISRDEVAEVLQYTPTTATVRRRPVLVVPPPIGRYYFLDLRPGRSFVEY
SVGRGQQTFLLSWRNPTAEQGDWDFDTYAGRVLRAIDEVREITGSDAVNLIGFCAGGILA
TTVLNHLAARGDDRVHSMAYAVTMLDFGDPALLGAFARPALIRFAKGRSRRKGLISARDM
GSAFTWMRPNDLVFNYVVNNYLMGRTPPAFDILAWNADGTNLPGALHGQFLDLFRDNLLV
EPGAFTVLGTPLDLTSITVPTFVSGAIADHLTAWRNCYRTTELLGGDTEFVLSFSGHIAS
LVNPPGNPKAHYWTGGTPGPDPDAWLKGAERQQGSWWQAWADWVLAHSGEEMPAPSAPGS
ARHPPLEAAPGRYVRDLPPD
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacacgatcggtgatcggggacagcgtcgaggagtcgatcggcggcggcgag
gacgtcgcgccgccgcggctcggggcggccgtcggtgccctggccgacgtgttcggtcac
ggccggaccgtggcccggcacggcgcggcgttcggcaaggaactggcgaagatcgccgcc
ggtcgatccacggtggcccccgccgaggggaaccgccggttcgccgatccggcgtggagc
acgcacccggcctaccgccggctcgagcagacctacctggccgccaccgacgccgtcgac
ggcgtcgtcgccgacgtcggccgcggcatcgacccacgccgggccgccgaggccaaattc
gccgccgacatcctcaccgccgccctggcgccgacgaactacctgtggaccaaccccgcc
gcgctgaaggaggcgttcgacaccgccggcctcagcctggtgcgcggcacgaagcacttc
gtctccgatgtggtcgagaaccggggcatgccgtcgatggtccgacgcggcgccttcacc
gtcggcaccgacctggcggtgaccccgggggcggtgatctcccgcgacgaggtcgccgag
gtgctgcagtacaccccgaccacggcgacggtccgccgccggccggtgctcgtggtgccc
ccgcccatcggccggtactacttcctggacctgcgcccgggacgcagcttcgtcgagtac
agcgtcggccgcggccagcagaccttcctgctgtcgtggcgcaatcccaccgccgagcag
ggtgactgggacttcgacacctacgccgggcgggtgctgcgcgcgatcgacgaggtacgg
gagatcaccggcagcgacgcggtgaatctgatcggcttctgcgccggcgggatcctcgcc
accacggtgctcaaccatctggccgcccggggcgacgaccgggtgcacagcatggcgtat
gcggtgacgatgctcgacttcggcgatccggcactgctcggcgcgttcgcccggcctgcc
ctgatccggttcgccaagggccggtcccgccgcaagggcctcatcagcgcccgggacatg
ggctcggcgttcacctggatgcgcccgaacgatctggtgttcaactacgtggtcaacaac
tacctcatggggcgcaccccgccggccttcgacatcctcgcctggaacgccgacggcacc
aacctgcccggcgccctgcacgggcagttcctcgacctcttccgggacaacctgctcgtc
gaacccggcgcgttcaccgtgctgggcacgcccctcgacctgacgtcgatcaccgtaccc
accttcgtctcgggcgcgatcgccgatcacctgaccgcgtggcgcaactgctaccgcacc
accgagttgctcggcggcgacaccgagttcgtgctcagcttctccgggcacatcgccagc
ctggtcaacccgcccggcaacccgaaggcgcactactggaccggtggcacaccgggcccg
gaccccgatgcctggctgaagggcgccgagcggcagcagggcagctggtggcaggcctgg
gccgactgggtgctcgcccacagcggggaggagatgcccgcgccgagcgcgcccggcagt
gcccggcatcccccactcgaggccgcccccggccgatacgtacgcgacctaccccccgac
tga

KEGG   Rhodococcus ruber: CS378_20170Help
Entry
CS378_20170       CDS       T05142                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00650  Butanoate metabolism
rrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CS378_20170
Enzymes [BR:rrz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     CS378_20170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ATQ30819
Position
4426856..4427956
Genome map
AA seq 366 aa AA seqDB search
MGLSGTAQRAVRNAWALFVGDGIEPPHDTASAVVADGPHRTLRRYGESDAGAPVLLVPPL
AAPARCYDLRPGQSLVQHLVATGRNVHVLDFGTMDRSDRHLGFEHWVDDIVPEAIARVAE
LCGGRDVDLAAWSLGGTLCLLTAAAHPGLPIRSITAFGTPIDYERIPFLGPARHLGRLVG
EPALTAVTHLLGGVPAPLVQLGYRATALERELTRPWFVARNLADAGTLARMEAIDRFQAD
MPGYPGRLFHQMAMRLTVANELATGRVRFEDRTIDLADVTVPVLALAGSDDVLAPVPAVE
AIGRVLPGSPHVRFEVVPGSHLGLLAGPAARGTSWAHFTGFLDDPAPVPPRTGRSGGDVV
RVPEFP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgggactgtcggggacggcgcagcgcgccgtgcgcaacgcgtgggcgctgttcgtcggc
gacggaatcgaaccaccgcacgacaccgcgtcggccgtcgtcgccgacggaccgcaccgt
accctgcgccgctacggtgagtccgacgcgggcgccccggtcctgctcgtgccgccgctc
gccgcgcccgcgcgctgctacgacctgcgccccgggcagagtctcgtgcagcacctcgtc
gccaccggtcgcaacgtccacgtcctcgatttcggcaccatggaccgctccgaccgtcat
ctcgggttcgaacactgggtcgacgacatcgtgcccgaggcgatcgcgcgggtcgccgaa
ctgtgcggcggccgcgacgtcgacctggccgcctggagcctcggcggaaccctgtgcctg
ctcaccgcggccgcccatcccgggttgccgattcgctcgatcaccgcgttcggcacgccg
atcgactacgagcgcatccccttcctcgggccggcccggcacctcggccgcctcgtgggc
gaacccgccctcacggccgtgacccacctgctcgggggcgtgcccgccccgctggtgcag
ctcggttaccgggccaccgccctcgaacgcgaactgacccggccgtggttcgtcgcccgc
aacctcgccgacgccggcaccctcgcccggatggaggcgatcgaccggttccaggcggac
atgcccggctacccgggccggctgttccatcagatggcgatgcgcctcacggtcgcgaac
gaactcgcgacgggccgggtccggttcgaggaccggacgatcgacctcgccgacgtcacc
gtgcccgtgctcgcactcgccggcagcgacgacgtgctcgcacccgtcccggccgtcgag
gcgatcggccgggtactgcccggatcgccccacgtgcggttcgaggtcgtgcccggcagc
cacctgggactgctcgccggccccgccgcccgcggcacgtcgtgggcgcacttcaccggg
ttcctcgacgaccccgcaccggtgccgccgcggaccggaaggtcaggcggggacgtggtc
cgcgtgcccgagttcccgtag

DBGET integrated database retrieval system