KEGG   Rhodococcus ruber: CS378_06125Help
Entry
CS378_06125       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_06125
   00650 Butanoate metabolism
    CS378_06125
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_06125
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_06125
   00310 Lysine degradation
    CS378_06125
   00360 Phenylalanine metabolism
    CS378_06125
   00380 Tryptophan metabolism
    CS378_06125
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_06125
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_06125
   00281 Geraniol degradation
    CS378_06125
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_06125
   00627 Aminobenzoate degradation
    CS378_06125
   00930 Caprolactam degradation
    CS378_06125
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_06125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ATQ28344
UniProt: A0A098BT54
Position
complement(1365226..1366005)
Genome map
AA seq 259 aa AA seqDB search
MAEFVTLEVSDGIGTIRLDRPPMNALNRQVQEEIRAAAREATVNSDVKAVIVYGGEKVFA
AGADIKEMAELSYVQMSEIIADLQSALGSVADIPKPTVAAITGYALGGGLELALGADRRI
AGDNAKVGVPEILLGIIPGGGGTQRLARLIGPSKAKDLVFTGRFVAADEALQMGLVDEVV
APDEVYAAARTWASQFTRGATRALAAAKAAIDQGLDTDLDTGLKIEQHVFAGLFATKDRT
IGMESFVANGPGKAEFVGE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcgtgacgctcgaggtctccgacggtatcggcaccatccggctcgaccgg
ccgccgatgaacgcactcaaccggcaggttcaggaggagatccgggccgctgctcgcgag
gcgaccgtgaactccgacgtcaaggccgtgatcgtctacggcggggagaaggtgttcgct
gccggcgcggacatcaaggagatggcggagctgagctacgtgcagatgagcgagatcatc
gcggacctgcagtcggcgctcgggtcggtggcggacatcccgaagcccacggtcgctgcg
atcaccggctatgcgctgggcggcggtctcgagctcgcgctgggtgcggatcggcggatc
gccggcgacaacgcgaaggtcggagtgccggagatcctgctcggcatcatcccgggcggc
ggcggaacccagcgcctggctcgcctgatcggcccgtcgaaggccaaggatctcgtgttc
acgggccgtttcgtcgcggcagacgaggctctgcagatggggctggtcgacgaggtcgtc
gccccggacgaggtatatgccgcggcgcgcacgtgggcatcgcagttcacccggggcgcc
acccgcgcgctggcggcggcgaaggcagcgatcgatcagggtctcgataccgacctggac
acgggcctgaagatcgagcagcacgtcttcgcgggcctgttcgccacgaaggaccgcacg
atcggcatggagtcgttcgtggccaacggtccgggaaaggcggagttcgtgggggagtag

KEGG   Rhodococcus ruber: CS378_08240Help
Entry
CS378_08240       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_08240
   00650 Butanoate metabolism
    CS378_08240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_08240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_08240
   00310 Lysine degradation
    CS378_08240
   00360 Phenylalanine metabolism
    CS378_08240
   00380 Tryptophan metabolism
    CS378_08240
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_08240
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_08240
   00281 Geraniol degradation
    CS378_08240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_08240
   00627 Aminobenzoate degradation
    CS378_08240
   00930 Caprolactam degradation
    CS378_08240
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_08240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Bclt
Motif
Other DBs
NCBI-ProteinID: ATQ28712
UniProt: A0A098BMF7
Position
complement(1869782..1870561)
Genome map
AA seq 259 aa AA seqDB search
MSETFVRYEVSEGFATLTLDSPHNRNAISARLVAQLRQGLADAAADDGVRAVVLTHEGGT
FCAGADLSEASTAEGGVAAAAAARTREMTAVLRSILELPKPVIGRIDGHVRAGGMGLVGA
CDLAVAGPRSTFALTEARLGLAASIISLTVLPRLTSRAASRYFLTGERFGPEVAAAIGLV
TVETDDPRAAVAEILAQLRECSPQGLGESKRLTTMRMLADFDRYGDALAEQSARLFGSPE
AVEGMTAFLQKRPPAWSRP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgagacgttcgtccggtacgaggtgagcgagggattcgccaccctcactctcgac
tcgccgcacaaccgcaacgcgatctccgccaggctcgtcgcgcagctccggcagggactt
gccgacgcggccgccgacgacggggtccgcgccgtcgtgctcacccacgagggcggcacc
ttctgcgccggggccgacctgagcgaggcgagcaccgcggagggcggcgtcgccgcggcg
gccgccgcccggacccgggagatgacggcggtgctgcgttcgatcctggagctgcccaaa
ccggtgatcgggcggatcgacgggcacgtgcgcgccggcggcatggggttggtcggcgcg
tgcgatctcgccgtcgccgggccccggtcgacgttcgcgctgaccgaggcccggctgggc
ctggccgcgtcgatcatctcgctgacggtgctgccgcggctcacctcccgcgccgcgagc
cgctacttcctcaccggggagcggttcgggccggaggtcgcggcggcgatcggcctggtc
accgtggagaccgacgatccgcgggccgcggtggcggagatcctcgcccagctgcgggag
tgttccccgcaggggctgggcgaatccaagcggctgaccacgatgcggatgctcgccgac
ttcgatcggtacggcgacgcgctggcggagcagtcggcgcggctgttcggctcgccggag
gcggtcgaggggatgaccgcgttcctgcagaagcggccgccggcgtggagccgtccgtga

KEGG   Rhodococcus ruber: CS378_11665Help
Entry
CS378_11665       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_11665
   00650 Butanoate metabolism
    CS378_11665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_11665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_11665
   00310 Lysine degradation
    CS378_11665
   00360 Phenylalanine metabolism
    CS378_11665
   00380 Tryptophan metabolism
    CS378_11665
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_11665
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_11665
   00281 Geraniol degradation
    CS378_11665
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_11665
   00627 Aminobenzoate degradation
    CS378_11665
   00930 Caprolactam degradation
    CS378_11665
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ATQ29319
Position
complement(2612774..2613562)
Genome map
AA seq 262 aa AA seqDB search
MAQFVSLEATADHVGVGIIRIDRPPLNLLSRQVQMEIAAAAEEANRRADINAVVVYGGPK
TLAAGADIKELHSMSSADLRADARRLQRDLGALADIVKPTVMAITGLAVGGGLELALGAD
WRIAAEDARLGLPETSLGIIPGGGGTQRLARLIGPSKAKELIFTGRVIGASEALGLGLVD
EVVTPDEVYDAALAWAGQFSRGASLAISNSKRAIDLGMQVDLAAGLRIEEGLFVEVFDTK
DRESGFQSFIDDGPGKAKYRGE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattcgtatctctcgaggcaaccgccgaccatgtcggcgtcggaatcatccgg
atcgatcgtccgccactcaatttgctgagtcggcaggtgcagatggagatcgctgccgct
gccgaggaggcgaaccggcgcgccgatatcaacgccgtagtggtgtacggaggtccgaag
accctggctgccggtgccgacatcaaggagctgcactcgatgagttcggccgacctccgt
gcggatgcccgacgactgcagagagacctcggtgccctcgcagacatcgtcaagccaacc
gtcatggcaatcaccgggctcgcggtcggtggcggtctcgaattagcacttggggcggac
tggagaattgccgccgaggatgcgaggctcggactcccagagaccagcctcggaatcatc
cctggaggcggaggcacccagagattggctcggttgatcggaccctccaaggccaaggaa
ctcatattcaccggtcgggtcatcggggccagcgaagcacttggcctcggactcgtcgac
gaagtagtcacacctgatgaggtgtacgacgccgctctggcgtgggcgggacagttcagc
cgcggggcttctctggcgatttcgaactccaaacgagccatcgacctcggaatgcaggtc
gatctcgcggcaggattgcgaattgaggagggtctcttcgtggaagtcttcgacacgaag
gaccgggagagcggctttcagtccttcatcgatgatggcccaggcaaggcgaagtacagg
ggcgagtaa

KEGG   Rhodococcus ruber: CS378_14425Help
Entry
CS378_14425       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_14425
   00650 Butanoate metabolism
    CS378_14425
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_14425
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_14425
   00310 Lysine degradation
    CS378_14425
   00360 Phenylalanine metabolism
    CS378_14425
   00380 Tryptophan metabolism
    CS378_14425
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_14425
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_14425
   00281 Geraniol degradation
    CS378_14425
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_14425
   00627 Aminobenzoate degradation
    CS378_14425
   00930 Caprolactam degradation
    CS378_14425
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_14425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ATQ29806
Position
3188889..3189653
Genome map
AA seq 254 aa AA seqDB search
MDTPVHVEQSDGVQIITINRPEVRNAINTETAVAIAAALEELDARDDLVAGVVTGAGKTF
CTGMDLKAFLAGERPSVEGRGFAGITEKSSDKPIVAAVEGHAVAGGFEIVLACDLVVASE
TAVFGLPEVKRGLLAGGGGLLRLPRKVPHQLAVEWSLTGEYFTAHTAYEAKLLNRLVPEG
QALAEAVALAKAIAKNGPLAVRATKQIIAQARDWSNDEEFERMREIYEPVRSSADAKEGA
LAFKEKREPVWQGR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggacacccccgtacacgtcgaacagtccgacggcgtgcagatcatcacgatcaaccgg
cccgaggtgcgcaatgcgatcaacaccgagaccgccgtcgcgatcgctgccgccctcgag
gaactcgacgcccgcgacgatctcgtcgccggcgtcgtcaccggtgccgggaagaccttc
tgcaccggcatggacctgaaggccttcctcgccggcgaacgcccttcggtcgaaggtcgc
ggctttgcgggcatcaccgagaaatcctccgacaagccgatcgttgcggcggtcgaaggg
cacgccgtcgcaggcggtttcgagatcgtgctcgcgtgcgacctcgtcgtcgcgtcggag
accgccgtcttcggcctgccggaggtcaagcgcggcctgctcgccgggggtggcggtctg
ctgcggttgccgcgcaaggttccccatcagctcgccgtcgaatggagcctcaccggcgag
tacttcacggcgcacacggcgtacgaggcgaagctgctcaaccggctcgtccccgagggg
caggcgctggccgaggccgtcgcgctggcgaaggcgatcgcgaagaacggcccgctcgcg
gtgcgcgccaccaagcagatcatcgcgcaggcccgggactggtccaacgacgaggagttc
gagcgcatgcgcgagatctacgaaccggtgcgttcctccgccgacgcgaaggaaggcgca
ctggcgttcaaggagaagcgcgaaccggtctggcagggacgctga

KEGG   Rhodococcus ruber: CS378_17260Help
Entry
CS378_17260       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_17260
   00650 Butanoate metabolism
    CS378_17260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_17260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_17260
   00310 Lysine degradation
    CS378_17260
   00360 Phenylalanine metabolism
    CS378_17260
   00380 Tryptophan metabolism
    CS378_17260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_17260
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_17260
   00281 Geraniol degradation
    CS378_17260
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_17260
   00627 Aminobenzoate degradation
    CS378_17260
   00930 Caprolactam degradation
    CS378_17260
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_17260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ATQ30313
Position
complement(3804948..3805730)
Genome map
AA seq 260 aa AA seqDB search
MTIDPIGVDVTIDDGILRITLDRPARMNAVTAATLEAVADAFEKHAGDDAVRVAVLTGAG
RAFCTGADLAGKDLSAPPSAETIDAANRTVAAIRAFPRPVVGAVNGPAAGVGVSLALGCD
LTVAAESAYLLLAFTRIGLMPDGGATALVAASIGRARALKMALLAERLPASEALAAGLIA
EVYPDDGFAAAVDALAARLAAGPVEAFRSTKDAINDATLGELDNAFGRERAGQLELLASA
DFHEGVSAFQEKRTAVFGRS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacccgatcggagtcgacgtgaccatcgacgacggcatcctgcgtatcacc
ctcgaccggcccgcccggatgaacgccgtcaccgccgccaccctcgaggccgtcgccgac
gccttcgagaagcacgccggcgacgacgccgtgcgcgtagcggtcctcaccggtgccggc
cgcgcgttctgcaccggtgccgacctcgccggcaaggacctgtccgcgccgccgtcggcc
gagaccatcgacgcggccaaccgcaccgtcgccgcgatccgcgctttcccgcggccggtc
gtcggcgccgtcaacggtcccgctgccggtgtcggtgtgtccctcgcactgggctgcgat
ctcaccgtcgcggcggagtcggcctacctgttgctcgccttcacccgcatcggcctcatg
cccgacggcggcgcgacggcactcgtcgccgcgtcgatcggtcgggcccgggcgctgaag
atggcgctgctcgcggaacggctgcccgcgagcgaggccctcgcggccggcctgatcgcc
gaggtgtaccccgacgacggtttcgccgccgccgtcgatgcgctcgccgcccggctcgcc
gccggccccgtcgaggccttccgttccacgaaggacgcgatcaacgacgcgaccctcggc
gagctcgacaacgcgttcggccgcgaacgagccggccagctcgagctgctggcgtccgcg
gacttccacgagggcgtgagcgccttccaggagaagcggacggcggtgttcgggcggagc
tga

KEGG   Rhodococcus ruber: CS378_17340Help
Entry
CS378_17340       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_17340
   00650 Butanoate metabolism
    CS378_17340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_17340
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_17340
   00310 Lysine degradation
    CS378_17340
   00360 Phenylalanine metabolism
    CS378_17340
   00380 Tryptophan metabolism
    CS378_17340
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_17340
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_17340
   00281 Geraniol degradation
    CS378_17340
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_17340
   00627 Aminobenzoate degradation
    CS378_17340
   00930 Caprolactam degradation
    CS378_17340
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_17340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 UPF0444
Motif
Other DBs
NCBI-ProteinID: ATQ31994
UniProt: A0A098BHU0
Position
3819720..3820481
Genome map
AA seq 253 aa AA seqDB search
MSAVLTEFGDGIAVMTINRPEARNAVDLEVAKALAAAVDEFEARPDLVVGIVTGAGGTFC
AGMDLKAFTRGERPSLPGRGFAGLTERPPTKPLIAAVEGWALAGGCELALSADLVVAARG
AKFGLPEVKRGLVAAAGGLLRLPKVLPYQLAMEIVLTGDPLTAEVAHAHGLVNTLTEPGA
ALDGARALAARISGNGPLAVRASKQIMSSAVQYTDAEAFASQRALVEPVFASADAQEGAR
AFAEKRAPVWRAE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctgtactgaccgagttcggcgacggcatcgccgtcatgaccatcaaccggccc
gaggcgcgcaatgccgtcgatctcgaggtcgccaaggcgctcgctgccgccgtcgacgag
ttcgaggcgcggccggacctggtcgtcgggatcgtcaccggcgccggcggcaccttctgc
gccggcatggacctcaaggcgttcacccggggcgagcggccgtcgctgcccggccgggga
ttcgccgggctcaccgagcgtccgccgacgaagccgctgatcgccgcggtcgagggctgg
gctctcgccggcggatgcgaactcgcgctctcggcggacctcgtcgtcgctgcccggggc
gctaaattcgggctgcccgaggtcaagcgcggactcgtcgcggcagccggcggcctgctg
cgcctgcccaaggtgctgccgtaccagctcgccatggagatcgtgctgaccggcgacccg
ctcaccgccgaggtggcgcacgcgcacggtctggtcaacaccctcaccgagccgggtgcg
gcgctggacggggcgcgggcgctcgccgcccgcatcagcggcaacgggccgctcgccgtc
cgggcgtccaagcagatcatgtcctcggcggtgcagtacaccgatgcggaggcgttcgcg
tcgcagcgggcgctcgtcgagcccgtgttcgcctccgcggacgcgcaggaaggcgcccgc
gcgttcgccgagaagcgcgcgccggtatggcgcgcggagtag

KEGG   Rhodococcus ruber: CS378_18335Help
Entry
CS378_18335       CDS       T05142                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01200  Carbon metabolism
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_18335
   00650 Butanoate metabolism
    CS378_18335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_18335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_18335
   00310 Lysine degradation
    CS378_18335
   00380 Tryptophan metabolism
    CS378_18335
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_18335
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_18335
   00281 Geraniol degradation
    CS378_18335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_18335
   00930 Caprolactam degradation
    CS378_18335
Enzymes [BR:rrz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CS378_18335
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_18335
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CS378_18335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored NAD_Gly3P_dh_N NAD_binding_2 PALP AlaDh_PNT_C 2-Hacid_dh_C DAO Sacchrp_dh_NADP UDPG_MGDP_dh_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ATQ30495
Position
4040733..4042883
Genome map
AA seq 716 aa AA seqDB search
MTENNMIGWERDADGIVVLTLDDPNQGANTMNELYKASMKATVDRLVAEKDDITGAVITS
AKKTFFAGGDLKNMIKVGPEDAQRIFDEVEAIKADLRRLETLGKPVVAAINGAALGGGLE
IALATHHRIAADVKGVQIGLPEATLGLLPGGGGVTRTVRMLGLQTALMQVLLQGQRYNPA
KAKEIGLIDEIVGSIDELVPAAKAWIKANPEGGVQPWDKKGFKIPGGTPASPAFAANLPA
FPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNASKIEGRYFTELVTGQVAKNMIQAFF
FDMQAINSGASRPNQADGTPFPKTTFRKVAVLGAGMMGAGIAYVCAKAGMDVILKDVSIE
SAQKGKAYSEGIEAKALSRGKTTEEKSAALLARITPSADVADLAGADLVIEAVFENTELK
HKVFQEIQDVVAPDAVLGSNTSTLPITGLAEGVTRQEDFIGLHFFSPVDKMPLLEIIAGE
KTSDATLAKAFDLAQQIRKTPIVVNDSRGFFTSRVIGTFVNEAIRMVGEGIEPATIEQAG
SQAGYPAPPLQLSDELNLTLMQKIRKETEAATEASGLKVPQDDSSTVVDFLVDEARPGRA
GGGGFYEYVDGKRSRIWPGLREKFDSAPTDIPIQDLIERMLFIEAIETQKCFDEGVLRTT
ADANIGSILGIGFPAWTGGVAQYIAGYPGGKEGFVKRAEELAAKYGERFTPPASLR
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagaacaacatgatcggctgggagcgcgacgccgacggcatcgtggtgctgacc
ctcgacgacccgaaccagggcgcgaacaccatgaacgagctgtacaaggcgtcgatgaag
gccaccgtcgaccgcctcgtcgccgagaaggacgacatcaccggtgccgtgatcacctcc
gccaagaagaccttcttcgccggcggcgacctgaagaacatgatcaaggtcgggccggag
gacgcgcagcggatcttcgacgaggtcgaggcgatcaaggcggacctgcgccggctcgag
accctcggcaagcccgtcgtcgccgcgatcaacggcgcggccctcggcggcggcctcgag
atcgcgctcgccacccaccaccgcatcgcggccgacgtcaagggcgtgcagatcggcctg
cccgaggccacgctgggcctgctgcccggcggtggcggcgtcacccgcaccgtgcggatg
ctgggtctgcagaccgcgctgatgcaggtgctgctgcaggggcagcgctacaacccggcc
aaggcgaaggagatcggcctgatcgacgagatcgtcggcagcatcgacgaactcgtcccc
gccgccaaggcgtggatcaaggccaaccccgagggcggcgtgcagccctgggacaagaag
ggcttcaagatccccggtggtaccccggcgtcgccggcgttcgcggcgaacctgccggcg
ttcccggcgaacctgcgcaagcagctcaagggtgccccgatgccggcgccgcgggccatc
atggccgccgccgtggagggctcgcaggtcgacatcgacaacgcgtcgaagatcgagggc
cggtacttcaccgagctcgtcaccggccaggtcgccaagaacatgatccaggcgttcttc
ttcgacatgcaggccatcaattccggtgcgtcacggccgaaccaggccgacggcacgccg
ttcccgaagaccaccttccggaaggtcgccgtgctgggcgccggcatgatgggcgcgggc
atcgcctacgtgtgcgccaaggccggcatggacgtgatcctcaaggacgtctcgatcgag
tcggcgcagaagggcaaggcgtactcggagggcatcgaggccaaggcgctctcgcgcggc
aagacgacggaggagaagtccgcggcgctgcttgcccgcatcactcccagcgcggacgtc
gccgatctggcgggtgcggacctcgtcatcgaggcggtgttcgagaacaccgagctcaag
cacaaggtgttccaggagatccaggacgtcgtcgcgccggacgcggtgctcggttcgaac
acctcgacgctgccgatcaccggtctcgcggagggcgtgacgcggcaggaggacttcatc
ggcctgcacttcttctcgccggtcgacaagatgccgctgctcgagatcatcgccggggag
aagacctccgacgcgacgctggccaaggcgttcgatctcgcccagcagatccgcaagacc
cccatcgtcgtcaacgactcgcggggcttcttcacctcgcgcgtcatcggcacgttcgtc
aacgaggcgatccgcatggtcggcgagggcatcgagccggcgacgatcgaacaggccggt
tcgcaggccggctacccggcgccgccgctgcagctgtcggacgagctgaacctgacgctg
atgcagaagatccgcaaggagaccgaggcggcgaccgaggcgtcgggactgaaggtgccg
caggacgattcgtccaccgtcgtcgacttcctcgtcgacgaggcccgtccgggccgtgcg
ggcggcggcggcttctacgagtacgtcgacggcaagcgcagccgcatctggccgggcctg
cgggagaagttcgacagtgcccccacggacatcccgatccaggacctgatcgagcggatg
ctgttcatcgaggccatcgagacgcagaagtgcttcgacgagggcgtgctgcgcaccacc
gccgacgccaacatcggctcgatcctcggcatcggcttcccggcctggaccggtggcgtc
gcccagtacatcgccggctaccccggcggtaaggagggcttcgtcaagcgcgccgaggaa
ctcgccgccaagtacggcgagcgcttcacccccccggcgtccctgcgctga

KEGG   Rhodococcus ruber: CS378_18500Help
Entry
CS378_18500       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_18500
   00650 Butanoate metabolism
    CS378_18500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_18500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_18500
   00310 Lysine degradation
    CS378_18500
   00360 Phenylalanine metabolism
    CS378_18500
   00380 Tryptophan metabolism
    CS378_18500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_18500
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_18500
   00281 Geraniol degradation
    CS378_18500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_18500
   00627 Aminobenzoate degradation
    CS378_18500
   00930 Caprolactam degradation
    CS378_18500
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_18500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ATQ30524
UniProt: A0A098BQD5
Position
complement(4076709..4077491)
Genome map
AA seq 260 aa AA seqDB search
MTPDPVLVDRDGPVTTIGINRPGVRNAVDRATAEALAAAFRAFDADDGAAVAVLHGTGGT
FCAGADLKAISEGHPNRVAPDGDGPMGVSRMRLSKPVVAAISGHAVAGGLELALWADLRV
AEEGAVLGVFCRRWGVPLIDGGTVRLPRLIGESRAMDLVLTGRPVDAGEALSIGLVNRLV
PAGQALTAARALAAEIAAFPQTCLRRDRLSLLEQHGLDEDQALLNEFRHGAVSLAHDTLE
GASRFAGGAGRHGSFGEPGT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggatccggtgctggtcgaccgcgacggcccggtcacgacgatcgggatcaac
cgtccgggggtccgcaacgccgtcgatcgggcgacggccgaggcgctggccgccgccttc
cgcgccttcgacgccgacgacggcgcggcggtcgccgtgctgcacggcaccggcggcacc
ttctgcgccggtgccgacctgaaggcgatcagcgagggacacccgaaccgggtcgccccg
gacggggacgggccgatgggcgtgtcgcggatgcggctgtccaagcccgtcgtcgccgcg
atctcggggcacgccgtcgccggcgggctcgaactggccctgtgggccgatctgcgcgtc
gccgaggagggggcggtcctgggcgtgttctgccgccgctggggcgtgccgctgatcgac
ggcggcacggtgcggctgccgcggctcatcggcgagagccgcgcgatggatctcgtcctg
accggccgtcccgtcgacgccggcgaggcgctgagcatcgggctggtcaaccggctcgtt
cccgccggtcaggcactcaccgcggcccgcgccctcgccgccgagatcgccgccttcccg
cagacctgtctgcgccgggaccgcctctcgctgctcgagcagcacgggctcgacgaggac
caggcgttgctcaacgaattccggcacggcgcggtctccctggcgcacgacacgctcgag
ggcgcgtcccggttcgccggcggtgccgggcggcacggcagtttcggtgagcccggcacc
tag

KEGG   Rhodococcus ruber: CS378_18995Help
Entry
CS378_18995       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_18995
   00650 Butanoate metabolism
    CS378_18995
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_18995
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_18995
   00310 Lysine degradation
    CS378_18995
   00360 Phenylalanine metabolism
    CS378_18995
   00380 Tryptophan metabolism
    CS378_18995
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_18995
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_18995
   00281 Geraniol degradation
    CS378_18995
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_18995
   00627 Aminobenzoate degradation
    CS378_18995
   00930 Caprolactam degradation
    CS378_18995
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_18995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ATQ30609
UniProt: A0A098BPI9
Position
4179670..4180500
Genome map
AA seq 276 aa AA seqDB search
MTQESRWKAFTVDVADHVALVTLVGPGKGNAMGPDFWTELPLLFGELDADPDVRAVVLAG
AGKHFSFGLDLPAMSGDLGKVLADKALAAPRTEFHEMVKRMQAAITAVADCRKPVVAAVQ
GWCIGGGVDLISAADIRYASADAKFSVREVKVGMVADVGSLARLPLIIGDGHLRELALTG
KDIDAARAEKIGLVNDVFEDADAVLTAAQATAAEIAANPPLVVHGIKAVLDHSRSPRVDD
SLRYVAAWNSAFLPSEDLTEAVAAVFEKRPPEFRGR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggaatctcgctggaaagcgttcacggtcgacgtcgcggaccacgtcgcgctc
gtcaccctcgtcggtccgggcaaaggcaacgccatgggccccgacttctggaccgagctg
ccgctgttgttcggcgagctcgacgcggatccggacgtgcgtgccgtcgtgctcgccggc
gccggcaagcacttctccttcggtctcgacctgcccgccatgagcggcgacctgggcaag
gtcctcgcggacaaggcgctggccgccccgcgcaccgagttccacgagatggtcaagcgg
atgcaggcggcgatcaccgcggtcgcggactgccgcaagcccgtcgtcgcggccgtgcag
ggctggtgcatcggcggcggcgtcgatctgatctccgcggccgacatccggtacgccagc
gccgacgcgaagttcagcgtccgtgaggtcaaggtcgggatggtcgccgacgtgggcagt
ctcgcgcgcctgccgctgatcatcggcgacgggcacctgcgcgagctggccctcaccggc
aaggacatcgacgcggcacgcgcggagaagatcggtctggtcaacgacgtcttcgaggac
gcggatgccgtcctgaccgccgcacaggccaccgccgccgagatcgcggcgaatccgccg
ctggtcgtgcacggcatcaaggccgttctcgaccacagccgctcgccgcgcgtcgacgac
agcctgcgctacgtcgcggcctggaactccgcgttcctgccgtcggaggatctgaccgag
gccgtcgcggcggtcttcgagaagcggcccccggagttccggggccggtag

KEGG   Rhodococcus ruber: CS378_19665Help
Entry
CS378_19665       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_19665
   00650 Butanoate metabolism
    CS378_19665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_19665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_19665
   00310 Lysine degradation
    CS378_19665
   00360 Phenylalanine metabolism
    CS378_19665
   00380 Tryptophan metabolism
    CS378_19665
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_19665
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_19665
   00281 Geraniol degradation
    CS378_19665
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_19665
   00627 Aminobenzoate degradation
    CS378_19665
   00930 Caprolactam degradation
    CS378_19665
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_19665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ATQ30731
UniProt: A0A098BR25
Position
complement(4325377..4326264)
Genome map
AA seq 295 aa AA seqDB search
MTVPYEPDVVTYEVRDGIAIVTLNRPDYRNAQNSVMTYALDAAFERAVEDDEVKVIVLAG
NGKHFSAGHDLGTPGRDHHVHYDNKAVMWWDHVDKPGGDQRYAREMEVYLGMCRRWREIP
KPTVAMVQGACIAGGLMLAWVCDLIVASEDAFFSDPVVRMGIPGVEYFAHPWVLGTRFAK
EILYTGDRFGAQRAYEVGMVNRVVPREKLEEETLALAGRIAEMPRFGLALTKRAVNQCED
QMGMRNGMDSVFGLHHFAHAHNAEVGTDSLGGMNAKSMAASARPVSGSAAQEGTK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccctacgagcccgatgtcgtcacctacgaggtgcgcgacggcatcgcgatc
gtcaccctcaaccggccggactaccgcaacgcgcagaactccgtgatgacctacgcgctc
gacgccgccttcgaacgcgccgtcgaggacgacgaggtcaaggtgatcgtgctcgccggc
aacggcaagcacttctccgccgggcacgacctgggcacccccggtcgtgaccaccacgtc
cactacgacaacaaggccgtcatgtggtgggaccacgtcgacaagcccggcggcgaccag
cggtacgcccgcgagatggaggtgtacctgggcatgtgccgccgctggcgggagatcccc
aagccgacggtggcgatggtgcagggcgcatgcatcgccggcggcctcatgctcgcgtgg
gtgtgcgacctgatcgtcgcctcggaggacgcgttcttctcggatccggtggtgcggatg
ggcattcccggcgtggagtacttcgcccacccctgggtcctgggcacgcgcttcgccaag
gagatcctctacaccggtgaccgcttcggtgcccagcgcgcctacgaggtcggcatggtc
aatcgtgtcgtgccacgcgagaagctcgaggaggagaccctcgccctggccggacggatc
gcggagatgccgcggttcgggctggccctgaccaagcgcgccgtcaaccagtgcgaggac
cagatgggcatgcgcaacggcatggactcggtgttcggcctgcaccacttcgcgcacgcc
cacaacgccgaggtcggcaccgactccctcggcggcatgaacgcgaaatcgatggccgcg
agcgcacgcccggtgagcggctctgccgcgcaggaaggaacgaagtag

KEGG   Rhodococcus ruber: CS378_19740Help
Entry
CS378_19740       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_19740
   00650 Butanoate metabolism
    CS378_19740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_19740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_19740
   00310 Lysine degradation
    CS378_19740
   00360 Phenylalanine metabolism
    CS378_19740
   00380 Tryptophan metabolism
    CS378_19740
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_19740
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_19740
   00281 Geraniol degradation
    CS378_19740
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_19740
   00627 Aminobenzoate degradation
    CS378_19740
   00930 Caprolactam degradation
    CS378_19740
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_19740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 HutP
Motif
Other DBs
NCBI-ProteinID: ATQ30742
UniProt: A0A098BSJ1
Position
complement(4338671..4339432)
Genome map
AA seq 253 aa AA seqDB search
MGITSTTDGAGITTVTVDYPPVNAIPSQGWFELADAVLAAGKDPATHVVILRAEGRGFNA
GVDIKEMQATDGHDALIAANRGCAAAFAAVYDCAVPVVVAVNGFCVGGGIGLVGNADVIV
ASDDAVFGLPEVDRGALGAATHLARLVPQHMMRTLYYTAQNVTAQQLEHFGSVYKVVPRA
ELDATAREIAGKIAAKDTRVIRCAKEAINGIDPVDVKDSYRFEQGFTFELNLAGVADEHR
DEFVATGKPRANH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcacctcgaccaccgacggcgcgggcatcaccacggtcaccgtcgactacccg
cctgtgaacgccatcccctcccaggggtggttcgaactggccgacgcggtcctcgccgca
ggcaaggatccggccacgcacgtggtgatcctgcgcgcggagggccgcggcttcaatgcc
ggcgtcgacatcaaggagatgcaggccaccgacgggcacgacgccctcatcgccgccaac
cgcggctgcgccgccgccttcgccgccgtctacgactgcgccgtgcccgtcgtggtcgcc
gtgaacggcttctgcgtcggcggcggaataggtctcgtcggcaacgccgacgtcatcgtc
gcctccgacgacgccgtcttcggcctgcccgaggtggaccgcggcgcgctcggcgccgcc
acccacctcgcccggctcgtgccgcagcacatgatgcgcaccctctactacacggcgcag
aacgtcacggcccagcagctcgagcacttcggttccgtctacaaggtggtcccgcgcgcc
gaactcgacgccacggcccgcgagatcgccgggaagatcgcggcgaaggacacccgcgtc
atccgctgcgccaaggaagccatcaacggcatcgacccggtggacgtgaaggacagctac
cgcttcgagcagggcttcaccttcgaactcaacctcgcgggcgtcgcggacgagcaccgg
gacgagttcgtcgccaccggcaaaccgcgcgccaaccactga

KEGG   Rhodococcus ruber: CS378_19815Help
Entry
CS378_19815       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_19815
   00650 Butanoate metabolism
    CS378_19815
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_19815
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_19815
   00310 Lysine degradation
    CS378_19815
   00360 Phenylalanine metabolism
    CS378_19815
   00380 Tryptophan metabolism
    CS378_19815
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_19815
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_19815
   00281 Geraniol degradation
    CS378_19815
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_19815
   00627 Aminobenzoate degradation
    CS378_19815
   00930 Caprolactam degradation
    CS378_19815
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_19815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ATQ30756
UniProt: A0A2D2A226
Position
complement(4354303..4355136)
Genome map
AA seq 277 aa AA seqDB search
MSTTASEVSGISAAAPHCLVEQRGPVLIVTMNRPEARNALSGEMMAIMAEAWDRVDNDPE
IRVAVLTGAGGAFCAGADLKAMNRSAPGDKFEQGDGGGWDLSRLPALLKGRRLTKPLIAA
VEGPAIAGGTEILQGTDIRVAGESAKFGVSEAKWGLFPLGGSAVRLVRQIPYTIAADILL
TGRHITAPEAKEIGLIGHVVPDGQALDKALEIAGTIAANGPLAVRAILKTIRDTEGMHEE
EAFEIDAKLGAEVFKSADAKEGPRAFAEKRAPKFTGA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccaccgcatcggaagtttccggcatttcggcagccgctccgcactgcctcgtc
gagcagcgcggtccggtcctgatcgtcaccatgaaccggcccgaggcgcgcaacgccctc
tccggcgagatgatggcgatcatggccgaggcgtgggaccgcgtcgacaacgatccggag
atccgggtggccgtcctgaccggcgcgggcggcgccttctgcgcgggcgccgacctcaag
gcgatgaaccggtccgccccgggcgacaagttcgagcagggcgacggcggaggatgggac
ctgtccaggctgcccgcgctgctcaagggccgccgcctcaccaaaccgctcatcgccgcg
gtggaggggccggccatcgccggcggcaccgagatcctccagggcaccgacatcagggtg
gccggcgagagcgcgaaattcggtgtgtccgaagcaaaatggggcctgttcccactcggt
ggctcggcggtgcggctcgtgcgtcagatcccctacacgatcgccgccgacatcctgctc
accggccggcacatcacggcccccgaggcgaaggagatcggcctgatcggccacgtcgtc
cccgacggtcaggcactcgacaaggccctcgagatcgccggcaccatcgccgccaacggc
ccgctcgccgtccgggccatcctgaagaccatccgcgacaccgagggcatgcacgaggag
gaggccttcgagatcgacgcgaagctcggcgccgaggtcttcaagagcgccgacgccaag
gagggcccccgcgccttcgccgagaagcgggccccgaagttcaccggcgcctga

KEGG   Rhodococcus ruber: CS378_21545Help
Entry
CS378_21545       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_21545
   00650 Butanoate metabolism
    CS378_21545
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_21545
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_21545
   00310 Lysine degradation
    CS378_21545
   00360 Phenylalanine metabolism
    CS378_21545
   00380 Tryptophan metabolism
    CS378_21545
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_21545
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_21545
   00281 Geraniol degradation
    CS378_21545
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_21545
   00627 Aminobenzoate degradation
    CS378_21545
   00930 Caprolactam degradation
    CS378_21545
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_21545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ATQ31068
UniProt: A0A098BSF9
Position
4718672..4719403
Genome map
AA seq 243 aa AA seqDB search
MMGISRDGDVVTLELRREERRNALNTELCVQVREGLEEALDGGARAVVITGRGSSFCAGA
DLSGDVYAEGFLDSLGEMLRAIQEAPVPVIAAINGPAIGAGTQLALAADLRVVAPGARFA
IPAARLGISVDRWTVRRLVSLLGGGPARAVLLAAEPVDAHEAVDRGLANRIGDLVAAQSW
AREIAELAPLSLHAMKLFLNDDGTRDEPSPEQTAALAAAWLSEDAQEARQARSERRAPVF
RGR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatggggatcagccgtgacggcgacgtggtcacgctcgaactgcggcgcgaggagcgc
cgcaacgcgctcaacaccgagctgtgcgtccaggtccgggaggggctcgaggaggccctc
gacgggggtgcgcgtgcggtcgtgatcaccgggcgcggctcgagcttctgtgccggcgcc
gacctgtcgggcgacgtctacgcggaaggattcctcgacagcctaggggagatgctccgt
gcgatccaggaggcgcccgtcccggtgatcgccgcgatcaacggccccgcgatcggtgcg
ggcacccagctcgctctcgcggcggacctgcgggtcgtcgccccgggcgcccgattcgcg
attccggcggcgcgtctcggtatctcggtggaccggtggacggtccggcggctggtctcc
ctgctcggcggcggccccgcgcgggccgtgttgctcgccgccgaaccggtcgacgcccac
gaggcggtcgaccgcggtctggccaaccggatcggcgacctcgtcgccgcgcagtcctgg
gcacgcgagatcgccgaactcgccccgttgtcgctgcacgcgatgaagctgttcctcaac
gacgacggcacgcgcgacgagccgtcgcccgagcagacggccgcgctcgccgcggcgtgg
ctcagcgaggacgcccaggaggcgcgccaggcccgctcggaacgccgggcgccggtcttc
cgcggtcgctga

KEGG   Rhodococcus ruber: CS378_23695Help
Entry
CS378_23695       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_23695
   00650 Butanoate metabolism
    CS378_23695
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_23695
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_23695
   00310 Lysine degradation
    CS378_23695
   00360 Phenylalanine metabolism
    CS378_23695
   00380 Tryptophan metabolism
    CS378_23695
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_23695
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_23695
   00281 Geraniol degradation
    CS378_23695
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_23695
   00627 Aminobenzoate degradation
    CS378_23695
   00930 Caprolactam degradation
    CS378_23695
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_23695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 UPF0444
Motif
Other DBs
NCBI-ProteinID: ATQ31447
UniProt: A0A2D2A431
Position
5176605..5177366
Genome map
AA seq 253 aa AA seqDB search
MSDEVLLERRGRILVITINRPEARNAVDAAVSHGLAAAVDELDADPDLSVGVLTGAGGTF
CAGMDLKAFVAGENIAVPGKGLGFTEAPPRKPIIAAVEGFALAGGTELVLATDLVVAATD
AKFGIPEVKRGLVAAGGGLLRLPTRIPYQKAMELALTGDAFTAEEAHGYGFVNVLTEPGG
ALAGALALAERITANGPLAVAATKEVIAKAADWPADEAFDRQREIVGPVFVSEDAREGAT
AFAQKRPPVWKGR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaggtcctgctcgagcgtcgcggtcgaattctggtgatcaccatcaaccgt
cccgaggcccgcaacgccgtcgacgcggccgtcagccacggcctcgcggccgccgtcgac
gaactcgacgccgaccccgacctgtccgtgggcgtgctcaccggtgccggcggcaccttc
tgcgccggtatggatctcaaggcgttcgtcgccggggagaacatcgcggtgccgggcaag
ggtctcggcttcaccgaggcgccgccgcgcaagccgatcatcgccgccgtcgagggcttc
gcgctcgccggcggcaccgaactcgtcctcgccaccgacctcgtggtcgccgccacggac
gcgaagttcggcatcccggaggtcaagcgcggactcgtcgccgcgggtggtggcctgctg
cgcctgcccacccggattccgtatcagaaggcgatggaactggcgctcaccggcgacgcg
ttcaccgccgaggaggcccacggctacggtttcgtcaacgttctcaccgagccgggcggt
gcgctggcgggcgccctggctctcgccgaacggatcacggccaacggcccgctcgccgtg
gcggccaccaaggaggtcatcgccaaggccgccgactggccggcggacgaggccttcgac
cgccagcgcgagatcgtcggcccggtgttcgtgtccgaggacgcccgcgagggtgcgacg
gcgttcgcgcagaagcgtccgccggtctggaagggccgctga

KEGG   Rhodococcus ruber: CS378_25005Help
Entry
CS378_25005       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_25005
   00650 Butanoate metabolism
    CS378_25005
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_25005
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_25005
   00310 Lysine degradation
    CS378_25005
   00360 Phenylalanine metabolism
    CS378_25005
   00380 Tryptophan metabolism
    CS378_25005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_25005
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_25005
   00281 Geraniol degradation
    CS378_25005
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_25005
   00627 Aminobenzoate degradation
    CS378_25005
   00930 Caprolactam degradation
    CS378_25005
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_25005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ATQ31678
Position
5472421..5473482
Genome map
AA seq 353 aa AA seqDB search
MTETEDVLVRVSGGIGRITLNRPKAINALNYDMVKAMAAALDEWAGDDSVRAVVVDGAGE
RGLCAGGDIVSIYHDARDGGTGSQDFWRDEYILNAAIGRYPKPYVAIMDGIVMGGGVGIA
AHGNVRIVTERSTIAMPEVGIGFVPDVGGTWLLSRAPGELGTHLALTTGRMKAGDAIALG
FADHFVPSEALDKFVAALESGTVDEALAEFARPAPESPLLAQRSWIDAAYSAPTVEEIVA
RLQTAEEPEARAAAEQILGKSPVALKATLRSVRHARELGSLEEVLNEEYRVSLASLRSHD
LVEGIRAQVVDKDRNPAWSPATLADVTDADVDAYFQPLGELELGLAAPEKETA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacggaagacgtcctcgtccgggtctccggcggcatcggccggatcaccctc
aaccggcccaaggccatcaacgccctgaactacgacatggtgaaggcgatggccgccgcg
ctcgacgagtgggccggggacgactcggtccgcgcggtcgtcgtggacggggcgggggag
cgcggcctgtgcgccggcggcgacatcgtctcgatctaccacgacgcccgcgacggcggc
accggctcgcaggacttctggcgcgacgagtacatcctcaacgccgccatcggccgctac
ccgaagccgtacgtcgcgatcatggacggcatcgtcatgggcggcggcgtcgggatcgcc
gcccacggcaacgtccggatcgtcaccgaacgctccacgatcgcgatgcccgaggtgggc
atcggcttcgtccccgacgtgggcggcacctggctgctctcgcgcgccccgggcgagctc
ggcacccacctcgcgctgaccaccggtcgcatgaaggccggcgacgccatagccctcggt
ttcgccgaccatttcgtgccgtccgaggcgctcgacaaattcgtcgccgccctcgaatcc
ggcacggtcgacgaggcgctcgccgaattcgcccgaccggccccggagtcgccgctgctc
gcgcagcgctcctggatcgacgccgcctactccgcgccgaccgtcgaggagatcgtcgcc
cgcctgcagaccgccgaggagcccgaggcccgcgcggccgccgagcagatcctcggcaag
tcgcccgtcgcgctgaaggcgaccctgcgctcggtgcggcacgcccgcgaactcggcagc
ctcgaagaggtgctgaacgaggagtaccgggtctcgctggcgtcactgcgctcgcacgat
ctcgtcgagggcatccgcgcccaggtggtcgacaaggaccgcaacccggcgtggtcgccg
gcgaccctcgccgacgtcaccgacgccgacgtcgacgcgtacttccagcccctcggcgag
ctcgaactcggcctcgccgcacccgagaaggaaaccgcctga

KEGG   Rhodococcus ruber: CS378_25015Help
Entry
CS378_25015       CDS       T05142                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00071  Fatty acid degradation
rrz00280  Valine, leucine and isoleucine degradation
rrz00281  Geraniol degradation
rrz00310  Lysine degradation
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00380  Tryptophan metabolism
rrz00410  beta-Alanine metabolism
rrz00627  Aminobenzoate degradation
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz00903  Limonene and pinene degradation
rrz00930  Caprolactam degradation
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01212  Fatty acid metabolism
Module
rrz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_25015
   00650 Butanoate metabolism
    CS378_25015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS378_25015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_25015
   00310 Lysine degradation
    CS378_25015
   00360 Phenylalanine metabolism
    CS378_25015
   00380 Tryptophan metabolism
    CS378_25015
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_25015
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS378_25015
   00281 Geraniol degradation
    CS378_25015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_25015
   00627 Aminobenzoate degradation
    CS378_25015
   00930 Caprolactam degradation
    CS378_25015
Enzymes [BR:rrz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS378_25015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ATQ31680
UniProt: A0A098BWQ4
Position
5474389..5475165
Genome map
AA seq 258 aa AA seqDB search
MTDFETILLDRKDRVGIITLNRPKALNALNSQLMREVVAAVEELDADAGIGAILLTGSEK
AFAAGADIKEMAPKTFSEVYAEDLFSQWDRLSSIRKPIVAAVSGYALGGGCELAMLCDFI
IASDTAKFGQPEIKLGVIPGIGGSQRLTRAVGKAKAMDMCLTGRNMDAEEAERAGLVSRV
VPAAELFDVALEAATTIASMSLPVAMMAKEAVNRSFETTLAEGVKFERRVFHSTFATADQ
KEGMAAFVEKRAPKFEHA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacttcgagacgatcctgctcgaccgcaaggaccgcgtcggcatcatcacgctc
aaccggcccaaggcgctcaacgccctcaacagccagctgatgcgcgaggtggtggcggcc
gtcgaggaactcgacgccgacgccggcatcggtgcgatcctgctcaccggatccgagaag
gcgttcgccgcgggcgcggacatcaaggagatggcgccgaagacgttctccgaggtgtac
gcggaagatctgttctcccagtgggatcggctctcgtcgatccggaagccgatcgtcgcc
gccgtctccgggtacgccctcggcggcggctgcgaactggcgatgctgtgcgacttcatc
atcgcctcggacaccgccaagttcggccagcccgagatcaagctcggcgtcatccccggc
atcggcggctcgcagcggctcacccgcgccgtgggcaaggccaaggcgatggacatgtgc
ctgaccggccggaacatggacgccgaggaggccgagcgggcgggcctggtctcgcgcgtc
gtgccggccgcggaactgttcgacgtggcgctcgaggccgcgaccacgatcgcgtcgatg
tcgctgcccgtcgcgatgatggccaaggaagcggtgaaccggtccttcgagaccaccctc
gccgagggcgtgaagttcgaacgccgggtgttccactcgacgttcgccaccgccgaccag
aaggaaggcatggccgcgttcgtcgagaagcgtgcaccgaagttcgagcacgcctga

DBGET integrated database retrieval system