KEGG   Rhodococcus ruber: CS378_08585Help
Entry
CS378_08585       CDS       T05142                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rrz  Rhodococcus ruber
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CS378_08585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HCMV_UL124
Motif
Other DBs
NCBI-ProteinID: ATQ28775
UniProt: A0A2D1ZWE1
Position
1938647..1939861
Genome map
AA seq 404 aa AA seqDB search
MTAELVVLLVVVVTALAFDFTNGFHDTGNAMATSIATGALKPKVAVALSASLNLVGAFLS
VEVAATVAKGVVNLDSTGGEALLLIVFAGLVGGILWNLATWLFGLPSSSSHALFGGLIGA
ALASLGIGGVVWDGVIGKVIIPALLAPVVAALVATVGTWSVHRITRAVPDETRGHGFRIG
QIGSASLVSLAHGTNDAQKTMGVIFLALVAHGSITADAEMPFWVKFSCAVAIALGTYLGG
WRIIRTLGKGLVEIAPPQGMAAESSSAAIILTSSHFGLPLSTTHVATGSILGSGLGTRSA
NVRWGVAGRMAVAWLITLPSAALVGALCWGLAHLIGGLPGVVVVFAVLCALSLLMYVRSR
RQPIDASNVTAEWDGKLAPAQTPAPAPAPEDVPAAPTTPTEGRP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcagagcttgtcgtcctcctggtggtggtagtcactgccctcgcattcgacttc
accaacggcttccacgacaccgggaacgcgatggcgacatcgatcgccaccggcgccctg
aaaccgaaggtcgcggtcgccctctccgcctcgctgaacctggtcggcgcgttcctgtcg
gtcgaggtcgccgcaacggtcgccaagggcgtcgtgaacctggacagcaccggcggcgag
gccctgctgctcatcgtgttcgccggtctcgtcggcggcatcctctggaacctcgcgacg
tggctgttcggcctgccgtcgagctcgtcgcacgcgctgttcggcggcctcatcggcgcg
gccctggcgtcgctcggaatcggcggcgtggtgtgggacggagtgatcggcaaggtgatc
attccggcgctgctggcgccggtggtcgcggccctcgtcgccacggtgggcacctggtcc
gtgcaccgcatcacccgcgcggtgcccgacgagacgcgcggtcacggcttccgcatcggc
cagatcggctcggcctcgctggtctcgctcgcgcacggcaccaacgatgcgcagaagacg
atgggcgtgatcttcctggcgctcgtcgcgcacggcagcatcaccgccgacgcggagatg
ccgttctgggtgaagttctcctgcgccgtcgcgatcgccctgggcacgtacctcggcggc
tggcgcatcatccgcacgctcggcaaggggctggtggagatcgcacccccgcagggcatg
gcggccgagtcgtcgtcggccgcgatcatcctcacctcgagccacttcggcctgcccctg
tcgaccacccacgtggcgaccgggtcgatcctggggtccggtctgggcacccgctcggcg
aacgtgcgctggggcgtcgcgggccgcatggccgtcgcctggctgatcaccctgccgtcg
gcggctctcgtcggcgcgttgtgctgggggctggcccatctgatcggcggcctgccgggt
gtggtggtggtgttcgcggtgctgtgcgcgctgtcgctgctgatgtacgtgcgctcgcgc
cggcagccgatcgacgcctcaaacgtcaccgcggagtgggacggcaagctcgctcccgcg
cagaccccggccccggccccggcgcccgaggacgtgccggccgcaccgaccactcccacg
gagggacgcccgtga

DBGET integrated database retrieval system