KEGG   Rhodococcus ruber: CS378_11105Help
Entry
CS378_11105       CDS       T05142                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00061  Fatty acid biosynthesis
rrz00071  Fatty acid degradation
rrz01100  Metabolic pathways
rrz01212  Fatty acid metabolism
rrz02024  Quorum sensing
Module
rrz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CS378_11105
   00071 Fatty acid degradation
    CS378_11105
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CS378_11105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rrz01004]
    CS378_11105
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rrz04147]
    CS378_11105
Enzymes [BR:rrz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CS378_11105
Lipid biosynthesis proteins [BR:rrz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CS378_11105
Exosome [BR:rrz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CS378_11105
  Exosomal proteins of breast cancer cells
   CS378_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ATQ29233
Position
complement(2493859..2495379)
Genome map
AA seq 506 aa AA seqDB search
MTNLSTNLVVSARNYPDKTALRCGEDTLSFAEFDAAAARVATLLARAGIAPGDRVAVMLP
NTAAFAIVFYGILRRGAVAVPMNPLLKAREIEFFLTNTAAAALFATPVFAEEARAAADVA
DARLWLVDDDALARLIADLPAQATPVPRAGEDTAVILHTSGTTGKPKGAELTHAGLAGNA
EVTARTLIQVGADDVVMGALPLFHVFGLTCGLNASVLVGAMLTLVPRFDPRTALEVIARD
RVTVFEGVPTMYAAMLGVAEEFDAAATASLRVCVSGGASLPVAVLEDFERTFDAVILEGY
GLSETSPVASFNHPDRVRKTGSIGTPIEGVRMRVVDGSGVEVPADRPGEIQIAGPNVMKG
YWNLPEATAAAIDAAGWFATGDIGRMDTDGYFYIVDRKKDLIIRGGFNVYPREIEEVVYE
HPAVAAAAVVGIPHDTLGEEIGAAVTLRVGMSADPVEIVKFVRQRVAAYKYPRHVWILDS
LPQGPTGKILRRDITIPTFESSSNRA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacctcagtaccaatctcgttgtgtcggcgcgcaactaccccgacaagaccgcc
ctgcggtgcggcgaggacacgctgtcgttcgcggagttcgacgcggccgcggcgcgggtg
gcaaccctgctcgcacgggcggggatcgcacccggtgaccgggtcgcggtgatgctgccc
aacaccgcggcgttcgcgatcgtgttctacggcattctgcgccgcggggcggtcgcggtg
ccgatgaacccgctgctgaaggcccgcgagatcgagttcttcctgacgaacaccgccgcg
gcggcgctgttcgcgaccccggtgttcgccgaggaggcccgcgctgcggccgatgtggcc
gacgcccggttgtggctggtggacgacgacgccctcgcccggctgatcgccgacctgccg
gcgcaggccaccccggtgccgcgggcgggtgaggacaccgcggtgatcctgcacacctcg
ggtaccaccggcaagcccaagggcgccgaactcacccacgccggactggccggcaatgcc
gaggtgaccgcccgcaccctgatccaggtcggagccgacgacgtggtgatgggcgcactg
ccgctgttccacgtcttcggactcacgtgcgggctcaacgcctcggtcctcgtgggcgcc
atgctcaccctggtgccgcgcttcgacccacggaccgcgctcgaggtgatcgcccgcgac
cgggtcaccgtgttcgagggcgtgccgacgatgtacgccgcgatgctgggtgtcgcagag
gaattcgacgcggcggcgacggcgagcctgcgagtgtgcgtgtccggcggtgcatcgttg
ccggtggcggttctcgaggacttcgagcggaccttcgacgcggtgatcctggaagggtac
gggttgtcggaaacctcgccggtcgcctcgttcaatcacccggaccgcgtccgcaagacg
ggctcgatcggcaccccgatcgagggggtgcggatgcgcgtggtggacggctccggtgtc
gaggtaccggccgaccgacccggcgagatccagatcgcgggaccgaacgtgatgaagggc
tactggaacctgcccgaggcgaccgcggccgcgatcgacgcggccggttggttcgccacc
ggcgacatcggccgcatggacaccgacggctacttctacatcgtggaccgaaagaaggac
ctgatcatccgcggtgggttcaacgtctacccccgcgagatcgaggaggttgtctacgag
catcctgccgtggcggcggccgcggtggtcggcatcccgcacgacaccctcggcgaggag
atcggcgccgcggtcacgctcagagtcggcatgagcgccgaccccgtcgagatcgtgaaa
ttcgtcagacagcgcgtcgccgcctacaagtatccgcgccacgtctggatcctcgactcc
ctgccccagggccccaccggcaagatcctgcgtcgcgacatcaccatccccacattcgaa
agcagcagcaaccgagcatga

DBGET integrated database retrieval system