KEGG   Rhodococcus ruber: CS378_19975Help
Entry
CS378_19975       CDS       T05142                                 

Definition
(GenBank) CoA transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00072  Synthesis and degradation of ketone bodies
rrz00280  Valine, leucine and isoleucine degradation
rrz00650  Butanoate metabolism
rrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CS378_19975
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CS378_19975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS378_19975
Enzymes [BR:rrz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     CS378_19975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ATQ30784
UniProt: A0A098BSN8
Position
complement(4390452..4391219)
Genome map
AA seq 255 aa AA seqDB search
MGTKVFGTPAAAVADVSDGATIAVGGFGLCGIPDALIRALVESGVGDLEVFSNNCGVDDH
GLGLLLNGRQIRRVTASYVGENKEFARQYLAGELEVELTPQGTLAERLRAGGAGIPAFFT
PAGVGTPVADGGLPWRYNVDGSVAVASPPKETRAFGDKRYVMEQGITADFALVHAVKGDT
AGNLIFDKTAMNFNPLAAMAGKVTVAQVEELVEPGELDPAQVHLPGIFVQRIVETGPQVK
RIEKRTVQATEGAAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgaaagtgttcggtacgcccgcggcggccgtcgcggacgtgtccgacggcgcg
acgatcgccgtcggcgggttcgggttgtgcggcatccccgacgccctgatccgcgcgctg
gtcgagtccggcgtcggcgacctggaggtgttctccaacaactgcggcgtcgacgaccac
ggcctgggcctgctgctcaacggtcggcagatccgccgggtgaccgcctcctacgtcggc
gagaacaaggagttcgcccgtcagtacctcgccggtgagctcgaggtcgagctcaccccg
cagggcaccctcgccgagcggctgcgggccggcggcgccggcatccccgccttcttcacc
cccgcgggcgtcggcacccccgtcgcggacggcggactgccgtggcggtacaacgtcgac
ggctcggtggccgtggcgtccccgccgaaggagacccgggccttcggcgacaagcggtac
gtgatggagcagggcatcaccgccgacttcgcactggtgcacgcggtcaagggcgacacc
gcgggcaacctgatcttcgacaagacggcgatgaacttcaatccgctggccgcgatggcc
ggcaaggtcaccgtcgcgcaggtcgaggaactcgtcgagcccggcgaactcgatcccgcc
caggtgcacctgccgggaatcttcgtgcagcgcatcgtcgaaaccggcccgcaggtcaag
cggatcgagaagcggacagttcaggccacggaaggggcggcacgatga

DBGET integrated database retrieval system