KEGG   Rhodococcus ruber: CS378_20555Help
Entry
CS378_20555       CDS       T05142                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00480  Glutathione metabolism
rrz00590  Arachidonic acid metabolism
rrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CS378_20555
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CS378_20555
Enzymes [BR:rrz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CS378_20555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ATQ30889
UniProt: A0A098BRJ2
Position
4519045..4519539
Genome map
AA seq 164 aa AA seqDB search
MTTSLQNIGINTLGGVPTSLAEFDGRAVLVVNVASKCGLTPQYTALEKLAVEYADRGLTV
VGVPCNQFMGQEPGTAEEIQTFCSTNYGVTFPLWEKIDVNGESRHPLYTELTRHPDANGE
AGDVQWNFEKFLVAPDGNVVARFRPRTEPDAPEVIAALEAALPR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttctctgcagaacatcggcatcaacaccctcggcggggtgccgacctccctc
gccgagttcgacggtcgcgcggtcctcgtggtcaacgtcgcctccaagtgcggcctgact
ccgcagtacacggcgctcgagaagctcgccgtcgagtacgcggaccggggcctgaccgtc
gtcggcgtgccgtgcaaccagttcatgggccaggagccggggaccgccgaggagatccag
accttctgctccaccaactacggcgtcacgttcccgctgtgggagaagatcgacgtcaac
ggcgagagccggcaccccctctacaccgaactcacccggcaccccgacgcgaacggcgag
gccggcgacgtgcagtggaacttcgagaagttcctcgtcgcacccgacgggaacgtcgtc
gcccggttccggccccgcaccgagcccgacgcccccgaagtgatcgccgccctcgaagcc
gcgttgccccgctga

DBGET integrated database retrieval system