KEGG   Rhodococcus ruber: CS378_22715Help
Entry
CS378_22715       CDS       T05142                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
rrz  Rhodococcus ruber
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CS378_22715 (mca)
Enzymes [BR:rrz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CS378_22715 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ATQ31275
UniProt: A0A2D2A3K0
Position
4964721..4965581
Genome map
AA seq 286 aa AA seqDB search
MAVHAHPDDESSKGAATTARYAAEGHEVLVVTLTGGERGDILNPAMDIPGIRDRMPEVRR
EEMAAAARILGVQQRWLGFVDSGLPEGDPKPPLPEGCFALVPLEEPTRKLVEVIREFRPH
VMTTYDENGGYPHPDHIRCHEVSVAAYEAAGDPDRFPEAGPAWKVQKLYYSHGFIRKRLE
LFREEYERRGEPFPMEEWLKRWRTEQGDIMARVTTQITCSDYFPKRDDALRAHATQIDPN
GSFFAVPLDIQQKVWPTEEFELAKTRVHTAIPETDLFAGIEDGQVR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcatgcccatcccgatgacgagtcgagcaagggtgccgccacgacggcccgc
tatgccgcggaagggcacgaggtgctggtggtcaccctgaccgggggtgaacgcggcgac
attctcaaccccgcgatggacatccccgggatccgggaccgcatgcccgaggtccggcgc
gaggagatggccgcggccgcccgcatcctgggggtgcagcagcggtggctcgggttcgtc
gactcggggctgccggagggcgacccgaagccgccgctgcccgaggggtgcttcgcgctg
gtgccgctcgaggaaccgacccgcaagctcgtcgaggtgatccgggagttccggccgcac
gtgatgaccacgtacgacgagaacggcggctacccgcaccccgaccacatccggtgccac
gaggtgtccgtcgcggcgtacgaggcggccggtgacccggaccgcttccccgaggccgga
ccggcgtggaaggtgcagaagctgtactactcgcacgggttcatccgcaagcgcctggag
ctgttccgcgaggagtacgagcggcggggcgagccgttcccgatggaggaatggctcaag
cggtggcgcaccgagcagggcgacatcatggcgcgggtgaccacgcagatcacctgcagc
gactacttcccgaagcgggacgacgcgctccgcgcccacgcgacgcagatcgatcccaac
ggctccttcttcgccgtgccgctggacatccagcagaaggtgtggccgacggaagaattc
gaattggccaagacccgcgtgcacacggcgatccccgaaacggatctgttcgcgggcatc
gaggacggacaggtgagatga

DBGET integrated database retrieval system