KEGG   Rhodococcus ruber: CS378_23185Help
Entry
CS378_23185       CDS       T05142                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00360  Phenylalanine metabolism
rrz00362  Benzoate degradation
rrz00621  Dioxin degradation
rrz00622  Xylene degradation
rrz01100  Metabolic pathways
rrz01120  Microbial metabolism in diverse environments
rrz01220  Degradation of aromatic compounds
Module
rrz_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CS378_23185 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS378_23185 (dmpG)
   00622 Xylene degradation
    CS378_23185 (dmpG)
   00621 Dioxin degradation
    CS378_23185 (dmpG)
Enzymes [BR:rrz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     CS378_23185 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm CoA_binding Glyco_trans_4_5 Aldolase SOUL
Motif
Other DBs
NCBI-ProteinID: ATQ31359
Position
complement(5069850..5070911)
Genome map
AA seq 353 aa AA seqDB search
MSTTDAATHTGRRKVTLVDTTLRDGMSSVSHRFTPENVADIARGLDRAGIPTIEVAHGIG
LGASSIQYGFAAATDPEYVRAAVDAVDNADIAVLYVPGIATLAELKSAIDAGIKTVRVAV
HCTEADCAQQPVEWAKEQGLNVMTFLMMSHKLDPEPLAEQAAKLDSYGADVVYVVDSAGA
MVPRHAGERVAALRQEISADIGFHAHNNLGVGIANALTAAENGATFIDGSLRGLGASAGN
AQTEVLAAAFERAGWDTAVDLFPLIDTAEHVVAPLMTDPQIIDETALILGYAGVYSTFFH
PTKRAAKKFGISTREILLELGRRGVIGGQEDMIVDVASELAGRTYELPARAGV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccaccgacgccgccacccacaccgggcgccgcaaggtcaccctcgtcgacacc
accctgcgcgacggcatgtcgtcggtctcgcaccgattcacccccgagaacgtcgccgac
atcgcccgcggcctcgaccgggccggcatccccaccatcgaggtggcccacggcatcggc
ctcggcgcctcctcgatccagtacggcttcgccgccgccaccgaccccgagtacgtacgc
gccgccgtcgacgccgtcgacaatgcggacatcgcagtgctgtacgtcccgggcatcgcc
accctcgccgaactgaagtccgcgatcgacgccggcatcaagaccgtgcgcgtcgcggtg
cactgcaccgaggccgactgcgcccagcagcccgtcgagtgggccaaggagcagggcctg
aacgtgatgacgttcctgatgatgagccacaaactcgacccggagccgctcgccgagcag
gccgccaagctcgactcctacggcgccgatgtcgtctacgtggtcgactccgccggcgcg
atggtgccccggcacgccggtgagcgcgtcgcggccctgcgacaggagatctccgccgac
atcggtttccacgcccacaacaatctcggagtgggcatcgccaacgcgctcaccgccgcc
gagaacggcgcgacgttcatcgacgggtccctgcgcgggctcggcgccagcgccggcaac
gcacagaccgaggtgctcgccgccgcgttcgagcgggccggctgggataccgccgtcgac
ctgttcccgctgatcgacaccgccgagcacgtcgtcgcgccgctgatgaccgacccgcag
atcatcgacgagaccgcgctgatcctgggctacgccggggtgtactcgaccttcttccac
cccaccaagcgggccgcgaagaagttcggcatctccacccgcgagatcctgctcgaactc
gggcgccgcggcgtcatcggcggccaggaggacatgatcgtcgacgtcgcctccgaactg
gccggccgcacctacgagctcccggcccgcgccggagtctga

DBGET integrated database retrieval system