KEGG   Renibacterium salmoninarum: RSal33209_0170Help
Entry
RSal33209_0170    CDS       T00641                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00620  Pyruvate metabolism
rsa00630  Glyoxylate and dicarboxylate metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSal33209_0170
   00630 Glyoxylate and dicarboxylate metabolism
    RSal33209_0170
Enzymes [BR:rsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RSal33209_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABY21926
UniProt: A9WLG6
Position
complement(147870..148844)
Genome map
AA seq 324 aa AA seqDB search
MVRPRGWHLPEKHMLINNKPIAGGLVDFGLYFFHNAKRLIAQGKGPYFYLPKIENHLEAR
LWNDIFILAQDFLGIPQGTIRATVLIETITAAFEMEEILYELRDHASGLNAGRWDYLFSV
IKNFRTRGPRFVLPDRNEITMTAPFMRAYTEQLVRACHRRGAMAIGSMAAFIPNRRDPEA
NEIAFGKVRADKTREATDGFDGSWVAHPDLVPVAMEVFNGVLGERANQIDKLREDVVPDD
KALLNVTATEGSITESGIRMNIEVGIRYIESWLCGNGAAAIHNLMEDAATAEISRSQIWQ
WIYAEAITDQGEIISENWVRELTD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggttcggccgcgcggctggcacttgccggaaaagcacatgctgatcaacaacaaacca
atcgcgggtggactggtcgattttggtctctacttcttccacaacgccaagcggctcatt
gcgcaggggaagggtccttacttctacttgccgaagattgaaaaccatctggaagcccgg
ttgtggaacgacatcttcattttggcgcaggattttctcggcattccgcagggcaccatc
cgagctaccgtactgatcgaaaccattaccgcagccttcgagatggaagagattctgtac
gaactgcgcgatcacgcctcgggtttgaacgcgggccgctgggattacctattctccgtg
atcaagaacttccgcacccgtggcccacgcttcgtgttgccggaccgcaatgagatcacc
atgacggcgccattcatgcgggcttacaccgagcagcttgttcgggcttgtcaccgacgt
ggcgcgatggccattggcagtatggctgctttcattccgaatcgccgggatcccgaagct
aatgaaatcgcgttcggcaaggttcgtgcggataagactcgtgaagcaactgatggcttt
gatggctcctgggtagcgcacccggatttggttccggtggctatggaggttttcaacggc
gttctgggcgagcgcgcgaatcagatcgacaagctgcgtgaagacgtggttcccgatgac
aaggcgctgctgaatgtcaccgcgaccgagggctcaatcaccgaatccggcatccgaatg
aacattgaggtgggtattcggtacatcgagtcttggttgtgtggaaatggtgcggctgcg
atccataacctgatggaagacgctgccaccgcagagatctcgcgctcgcaaatctggcag
tggatctacgccgaggccatcactgatcagggcgagattatctcggaaaactgggtgcgt
gagctgaccgactaa

DBGET integrated database retrieval system