KEGG   Renibacterium salmoninarum: RSal33209_0554Help
Entry
RSal33209_0554    CDS       T00641                                 

Definition
(GenBank) 3-ketoacid-CoA transferase, beta subunit
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00072  Synthesis and degradation of ketone bodies
rsa00280  Valine, leucine and isoleucine degradation
rsa00650  Butanoate metabolism
rsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RSal33209_0554
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RSal33209_0554
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSal33209_0554
Enzymes [BR:rsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     RSal33209_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: ABY22303
UniProt: A9WL34
Position
463192..463851
Genome map
AA seq 219 aa AA seqDB search
MATETKGLSRNELAARVAQELENGQYINLGIGMPTLIPNYIPADVEVVLHSENGILGTGP
YPTEDAVDPDLINAGKETVTVNKGAAFFDSAASFGMVRGGHVDVAVLGAMEVVQNGDLAN
WMIPGKMVKGMGGAMDLVFGAKRLIVMMEHVDRNGNPKILAECTLPLTGKGCVNRIITDL
AVIDVVPGEGLVLREVAPGLSVEEVIAATGAPLKVELDV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaaacaaaaggtctttctcgaaacgaactggccgcacgagtagcccaagag
ctcgaaaatgggcaatacatcaatcttggcatcggtatgccgacgctgattccgaactac
atcccggccgacgtcgaggtagtgctgcattctgaaaacgggattctgggtactggaccg
tacccgaccgaagacgcggtggaccccgatttaatcaacgctggcaaagagaccgtgacc
gtcaataaaggcgcagccttcttcgactcggcggcctcctttggcatggtccgtggcggg
cacgtcgatgttgcggtgcttggtgcgatggaagtagtccaaaacggtgacctggctaac
tggatgattccgggcaaaatggtcaaaggtatgggcggcgcaatggacttagtctttggt
gccaagcggctaatcgtgatgatggagcatgtcgatcggaacggaaacccgaagattttg
gccgaatgcacgctgcccttgactggtaaaggctgcgtcaaccggatcattaccgacctc
gccgtgatcgacgtcgttcctggcgaaggtttggtgcttcgcgaggtagcgcctgggctt
tcggtcgaagaagttattgccgccaccggtgccccgctgaaagttgaactcgatgtctga

DBGET integrated database retrieval system