KEGG   Renibacterium salmoninarum: RSal33209_1180Help
Entry
RSal33209_1180    CDS       T00641                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00300  Lysine biosynthesis
rsa01100  Metabolic pathways
rsa01120  Microbial metabolism in diverse environments
rsa01230  Biosynthesis of amino acids
Module
rsa_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RSal33209_1180
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RSal33209_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABY22918
UniProt: A9WPB4
Position
999612..1000685
Genome map
AA seq 357 aa AA seqDB search
MRFDLHADVAELAAALLDVESVSANEKQIADFVEEALHALPHLTVLRDGDSIIARTELGR
AERVILAGHLDTVPLPTTPGARGTVPSSWSDGVLYGRGATDMKGGVAVQLALAAALTEPN
RDLTFVFYDHEEVEADLSGLGRLAKNHRELLNADFGILLEPTDGVVEGGCNGTMRFEARM
HGKAAHAARAWMGHNAIHDAAEILNRLRDYAPLTVSVEGLDYRESLNAVKIRGGIAGNVI
PDEAVVEINYRFAPNKTIEQAEAVVLELLAGLDITRTDAAPGARPGLDQPAAAAFVAAVG
GTPKPKFGWTDVARLGQLGIPAVNFGPGDPLLAHSDDEHVSGQAIRDCLAALTRWLS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttgacctgcacgctgacgttgccgagctggctgccgccctcctcgatgttgag
agtgtttcagctaacgaaaaacagattgctgatttcgttgaggaggccttgcatgcgctt
ccgcatctaacagtgttgcgcgacggtgattcgatcattgcgcgaaccgagcttggccgg
gcggagcgggttattttggctgggcacttagataccgtgccattgccgacgacgccggga
gcacgcgggacggtaccttccagctggtcggatggggtgctatacggtcggggtgccacc
gatatgaagggcggcgtggccgtgcaattggcgctcgctgcggcgctcaccgaaccaaac
cgggatcttacctttgtgttttatgaccatgaagaggttgaagcggatctgagcggcctg
ggccggctggctaaaaatcatcgtgagctattgaacgcagatttcggcattctgttggag
cctaccgatggcgtagtggagggtggctgcaacggcacgatgcggtttgaagcccggatg
cacggcaaagcagcacacgcagccagggcttggatggggcataacgcaattcacgatgct
gctgagattttgaaccggctgcgcgattacgcgccgttaacggtatcggtggagggtctt
gattatcgggagagcttgaacgcggtaaaaattcgcggcggcattgctggaaacgtcatc
ccagatgaagcggttgtggagatcaattaccgcttcgcgccgaataagaccatagaacag
gctgaggccgtggtgcttgagttgcttgccggattagatataacccgtactgacgctgct
ccgggtgcgcgaccgggcttggaccagccagcggctgcggcttttgtcgcggcggtaggt
ggcaccccgaaacccaagtttggttggaccgacgtcgcccggcttggacaactgggcatc
ccggccgtgaactttggcccgggggatccgttacttgcgcatagcgatgatgaacatgtc
agcggccaggcaatccgtgattgcctggccgcgttgacgcgttggttgagctaa

DBGET integrated database retrieval system