KEGG   Renibacterium salmoninarum: RSal33209_1510Help
Entry
RSal33209_1510    CDS       T00641                                 

Definition
(GenBank) dehydrogenase, E2 component, acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00010  Glycolysis / Gluconeogenesis
rsa00020  Citrate cycle (TCA cycle)
rsa00620  Pyruvate metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
Module
rsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSal33209_1510
   00020 Citrate cycle (TCA cycle)
    RSal33209_1510
   00620 Pyruvate metabolism
    RSal33209_1510
Enzymes [BR:rsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RSal33209_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABY23246
UniProt: A9WNM8
Position
complement(1294738..1295046)
Genome map
AA seq 102 aa AA seqDB search
MPDLGEGLIDATVLEWLVAEGDQIERNTPMVEVETTKSSVELPSPQAGKVVKIFGEPGDV
IQVGDPLIIFEVPDDTAGIVGTVPTEEAPKRRVRLSMNLDED
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
ttgccggatctgggcgaaggcttgatcgatgcaaccgtgcttgagtggttggtagccgaa
ggcgatcagattgaacgaaacacgccgatggttgaagtagagaccactaaatcatcggtg
gaactcccctcaccgcaagccggaaaagttgtcaagattttcggtgaacctggcgacgta
attcaggtcggcgacccgctgattatcttcgaggtgccagatgacacggccgggatcgtt
ggcaccgtcccgaccgaagaagcaccgaaacgtcgggttcgtttgtccatgaacctggat
gaggactaa

DBGET integrated database retrieval system