KEGG   Renibacterium salmoninarum: RSal33209_2160Help
Entry
RSal33209_2160    CDS       T00641                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RSal33209_2160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rsa03011]
    RSal33209_2160
Ribosome [BR:rsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RSal33209_2160
  Bacteria
    RSal33209_2160
  Archaea
    RSal33209_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Pardaxin
Motif
Other DBs
NCBI-ProteinID: ABY23892
UniProt: A9WSV4
Position
complement(1907760..1908125)
Genome map
AA seq 121 aa AA seqDB search
MEAKAIARHIRVTPMKARRVVNLIRGKQANEALAILKFAPQAASEPVFKVLQSAVANARV
LADRDSVAFDEGDLFISEAFVDEGPTMKRFQPRAQGRAYRIRKRTSHITVVVATPASEED
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggccattgcgcggcacatccgcgtaacgcctatgaaggcccggcgcgtc
gtcaacctgattcgtggcaagcaagcgaatgaggccctggcgattctgaagtttgcccca
caggcagcttcggagccggtattcaaagtactccagtccgcagtggctaacgcccgcgtt
ctggccgaccgggacagcgtggccttcgacgaaggcgacctcttcatcagcgaagcattc
gttgatgaaggcccgaccatgaagcggttccagccgcgtgctcaagggcgcgcataccgc
atcagaaagcgcaccagccacatcaccgtggttgtcgctacacctgcgagcgaggaggac
cgctaa

DBGET integrated database retrieval system