KEGG   Renibacterium salmoninarum: RSal33209_2334Help
Entry
RSal33209_2334    CDS       T00641                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01130  Biosynthesis of antibiotics
rsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSal33209_2334
Enzymes [BR:rsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RSal33209_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh QRPTase_C DUF1863 His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABY24064
UniProt: A9WR55
Position
complement(2074174..2074980)
Genome map
AA seq 268 aa AA seqDB search
MSVSVLDDIIAGVREDLAVRQADVSLEALQSLVAAQAPAMDALAALRSPGVSVIAEVKRR
SPSKGQLADIPDPAVLAAGYASGGAAVISVLTEQRRFSGTLADLDAVRKAVQIPVLRKDF
AVEAYQILEARAHGADLILLIVAALSDDQLREFLALTEQLGMNALVETHTAEEIERALAI
GAKIIGINVRNLKTLDVDRGVFSALSALVPSGGILVAESGVKDAADVAHYAQHGATAVLV
GEALVSDADPAERISEFRAAGAAAHTPA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ctgagcgtgagcgtcctggacgacatcatcgcgggagttcgcgaagacctcgccgtcagg
caagctgacgtctcactcgaagcactccagagcctcgttgcagcgcaagccccagcaatg
gacgcccttgctgccttgcgctcacctggtgtgagtgtgattgcggaggtgaaacgacgc
agtccctccaaagggcagctggccgacattccagatccggctgtgctagcggctggttac
gcctctggcggcgcggctgtcatcagtgttttgaccgaacaacgacggttttccggcact
ttagctgatctggatgcggtgcgtaaagcggtgcagatcccggtattgcgcaaagatttc
gccgttgaggcctatcaaattttggaagcccgcgcccatggagcggatctgattctactt
attgttgcggcgctcagcgatgaccaattgcgtgagttcctagcgttgactgagcaactt
ggtatgaacgccttagtagagacacacacggcggaggaaatcgagcgggcgctagcgatc
ggtgccaagattatcggaatcaacgtccgcaatcttaaaacgcttgatgtagaccgcgga
gtcttttctgccttgtcagctctcgtgccctccggtggcatcctggtcgccgaatccggc
gtcaaagatgcagctgacgttgcccactatgctcaacatggcgctaccgcggttctggtg
ggtgaagcattagttagcgatgccgacccggccgaacggatttccgaatttcgggctgct
ggtgccgcggcccataccccagcctga

DBGET integrated database retrieval system