KEGG   Renibacterium salmoninarum: RSal33209_3172Help
Entry
RSal33209_3172    CDS       T00641                                 

Definition
(GenBank) low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rsa  Renibacterium salmoninarum
Brite
KEGG Orthology (KO) [BR:rsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RSal33209_3172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABY24889
UniProt: A9WUL8
Position
2820178..2821197
Genome map
AA seq 339 aa AA seqDB search
MAVVTAIFFALICLFAALFTMLNGVRDVASTIAVAVRTRALTPGIAVVLAGFFNLLGALL
SGGLALALHDQLFVLRPGAEGLSIILAALIAALIWGIQQWWIGYPSSSTHALLGGIGGAA
GAAMLKGAPGLAGLDSTLIWLVVLPLLVSPVIAFAASYLLVFPIAWFSRYAQPNNINRRF
RRAQAVAAGSVAFGHGLQDGSRITTLLLFAVVAAGYGDLDGAIWWLACAVGIFLTLGTLA
GGWRIGYTLSSRLVKVDPMRGFVAQSVSAVMLLIGSIGLHLPLATTQLTTASIIGAGVNQ
RFSVTNGRLAGKILLSWFATPVVSAVISGVLYLALSSLM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgtcacggctatcttttttgcgcttatttgcttgttcgcagcactcttcacc
atgctcaacggcgttcgagatgtcgcttccaccatcgccgtcgcagtgcggacccgggca
cttacgccgggcatcgccgtcgtgctggccggcttttttaatcttttgggtgccttactc
agcggtggactcgctttggctctgcacgaccagctgttcgtgctgaggcctggcgctgaa
ggattgtcgatcattctcgctgcgctcatcgcggctctgatctggggcatccagcagtgg
tggatcggttacccgtcgtcgtcaacgcacgcactgctgggcggaatcggcggcgctgcc
ggggcagcaatgcttaagggcgccccgggcctagccggtcttgattcaacgcttatttgg
ctcgtggtgctgccgctgctggtctcccccgtgatcgcctttgccgcgtcctatttgctc
gttttcccgatcgcctggttttcgcgctatgcacaaccaaacaacatcaaccggcggttc
cggcgcgctcaagcagtcgctgcaggttcagtggcctttgggcacggtctacaggatggc
tcgcggatcaccacgttgctgctctttgcggtagtggccgccggctatggcgaccttgat
ggcgccatttggtggctagcctgcgccgtaggcatcttcctcaccctgggcacactcgca
ggcggctggcggattggctacacgctgtccagccgcttggtaaaggttgatccgatgcga
ggctttgtggcccaatctgtcagcgctgtaatgctgttgatcggcagtatcggcttacat
ctacctttggcgacaactcaactcacgacggcgagcatcataggtgccggcgtcaaccag
cggttttcagtaactaacggcaggctcgcgggaaaaatcctgctttcctggtttgccacc
ccagtagtaagtgcggtaatctccggggtgctttacctagcgctgtcgtcactgatgtag

DBGET integrated database retrieval system