KEGG   Renibacterium salmoninarum: RSal33209_3403Help
Entry
RSal33209_3403    CDS       T00641                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00511  Other glycan degradation
rsa00520  Amino sugar and nucleotide sugar metabolism
rsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSal33209_3403
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RSal33209_3403
Enzymes [BR:rsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RSal33209_3403
Chaperones and folding catalysts [BR:rsa03110]
 Intramolecular chaperones
  Others
   RSal33209_3403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Motilin_assoc
Motif
Other DBs
NCBI-ProteinID: ABY25113
UniProt: A9WV92
Position
complement(3019326..3020375)
Genome map
AA seq 349 aa AA seqDB search
MHLHLTDDQGWRIAIEAYPELTKTGASTQSGFAPGTVDPVAGGGPWFYSKAQYAELISYA
ASRFVEIVPEVDGPGHTSAALASVPEINNDGRAIAPYSGFDVGISLVGLQDQPHRDQVKI
FLTSVLNEVAAQNPGRYLHVGGDESPKATAEQYTAYTALANEAATAAGKTVIAWHEWIKG
AALPDGAVMQYWGTEPGSADAAMARKAVDSGHQLILSPANRSYLDMKYDAATAYGRRWAG
LINLRTAWNWEPTTVLGVEASLWSDSANQFGDQPFGPTRLYASAKDYTDFMLFPRLPAVA
ELGWSPSVDRSSDAGYQDLVQRTLAHSKRWDVLGIGYNKAADIPWSSRS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgcatttgcaccttaccgatgatcaaggctggcgcatcgccatcgaggcctatccggaa
ttgaccaagaccggggccagcacacagagtggctttgcgccgggaactgttgatccggtt
gctggcggtgggccctggttttacagcaaggcccagtacgccgagctcatcagttacgcg
gcaagccggtttgttgagattgtgccggaggttgatggtcccggacatacttcggctgca
ctggcatcggtgcctgagatcaacaatgacggtcgagccattgcaccctactcaggcttc
gacgtcggcatctcgttggtgggattgcaggatcagccgcatcgagaccaagtcaaaatc
ttcctcacctcggtgctgaacgaggtggccgcgcaaaaccctggacgctatctgcacgtt
ggtggtgacgaatcgcctaaggccactgcagagcagtacaccgcgtacaccgcgctggcg
aatgaggcagctactgcggccggcaagaccgtgatcgcttggcacgagtggatcaaaggt
gcagcactgccggatggcgccgtgatgcagtattgggggaccgagccgggatccgcggac
gccgcaatggcgaggaaagccgtcgattccgggcatcaattgatcctctcgccggcaaac
cggtcctatttggacatgaagtacgacgccgcaacggcttatggacggcgctgggctggc
ctcatcaaccttcggacagcctggaattgggagccgacgacggtgctcggcgtcgaagca
tcgttgtggagtgatagcgccaatcaatttggtgatcagccttttgggccaactcgtctt
tacgcctctgccaaggattacaccgatttcatgcttttcccacggcttcctgcagttgcc
gaacttggctggagcccctcagtagaccgcagttctgacgccggttaccaggatcttgtt
cagcgcaccctggcgcattccaaacgttgggacgtgctgggtatcggttacaacaaagcc
gcggacattccctggagctcaagaagctaa

DBGET integrated database retrieval system