KEGG   Renibacterium salmoninarum: RSal33209_3504Help
Entry
RSal33209_3504    CDS       T00641                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00430  Taurine and hypotaurine metabolism
rsa00460  Cyanoamino acid metabolism
rsa00480  Glutathione metabolism
rsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RSal33209_3504
   00460 Cyanoamino acid metabolism
    RSal33209_3504
   00480 Glutathione metabolism
    RSal33209_3504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rsa01002]
    RSal33209_3504
Enzymes [BR:rsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     RSal33209_3504
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     RSal33209_3504
Peptidases and inhibitors [BR:rsa01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   RSal33209_3504
CD molecules [BR:rsa04090]
 Proteins
  RSal33209_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABY25213
UniProt: A9WVJ2
Position
3108613..3110142
Genome map
AA seq 509 aa AA seqDB search
MGQGPAPAAANREHYLAEGLDLVPGSGALAAAVPGAVDAWLILLRDHGTWALAKVLDYAR
DGHPVAAGVCRTISTVKELFNEHWPTSAAQWLPDGKVPQPGQLVRNEAWADSLQRLASAG
NADRVASIEAARALWRSDIAQAVADFAKQPHRHSSGSDHAGVITAADFQSFEAGYEEPVS
IEFRGHTVVKVGAWSQGPALLQTLRILDGFDDEQLDPSTALGVHTILEAQKLSYADRDAY
YGDSNNIPLEVLLSVEYADRRRKLITEQASHEFKPGEIDQIEAFLPPLRTEYAASGMGYT
IAGVGEPTVRPTGETRGDTCHLDVVDHWGNMISATPSGGWLQSSPYAPEVGFCLGTRLQM
TWLEDGGPATLQPGKRPRTTLTPTLVLKDGKAVAALGSPGGDQQDQWQLLYLLRTIVGGY
ESQQAIDAPSFHTTSLAGSFWPRTWEPGGTVVENRLGIEVIAELERRGHVVTRAGDWALG
RLSVAGSADDGVLYAAANPRGMQGYAAGR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggccaggggccagcgcccgcggcagccaatcgcgagcattacttagctgaaggacta
gatctggtgcccggctccggcgcgctagcagccgccgtgcccggcgcggtcgacgcatgg
ctgatcttattgcgcgaccatggcacttgggccttggccaaggtacttgactacgcgcgc
gatggtcacccggtagccgccggcgtgtgccgcaccatcagcacggtgaaagagcttttc
aacgagcactggccgacgtcggctgcgcagtggctacccgacggcaaggttccgcagcct
ggccagttggtgcgcaacgaggcgtgggcggactcccttcagcgactcgcctcagccgga
aacgccgatcgggttgccagcatcgaggcggcccgggccttgtggcgcagtgatatcgct
caggcggtggcggatttcgcaaaacaaccgcaccggcactcttcgggctcagaccatgcc
ggcgtgattaccgccgctgatttccaatctttcgaagccgggtatgaggagcctgtgagc
atcgaattccgcggccataccgtggtcaaagttggcgcttggagccagggccccgcgcta
ctacagacgctaagaattctcgacggctttgacgatgagcaattagatccttcgaccgcg
ctcggagtgcacacaatcctcgaagcgcagaagctttcgtatgcagatcgcgacgcctac
tatggcgacagcaataatattccgcttgaggtacttctctcagtggagtacgcggacaga
cgccgaaagctcatcaccgagcaggcgagtcatgagttcaagccgggcgaaattgatcag
atcgaagccttccttccgccacttcggaccgaatatgccgcttccggcatgggttacacc
attgcgggagttggtgagccgacagtgcggccaactggcgaaactcgtggcgatacttgt
catcttgatgtggtggaccattggggaaacatgatttccgcaacgccttctggtggctgg
ctgcagagctcaccgtatgcacccgaagttggcttttgcctgggcactcggttgcaaatg
acctggcttgaagatggcggtccggcgactctccagccagggaaacggccacggacaacg
ctcacaccaactttggtactcaaggacggcaaagctgttgccgcactaggctcgcccggc
ggtgatcagcaagatcagtggcagctgctgtacctcttgcgcactatcgtgggcggctat
gagtcacaacaggcaatcgatgcgccgtcgttccataccacctcgttagccggctcgttc
tggccgcggacgtgggagcccggtggcaccgtcgtcgaaaatcggctgggtatcgaagtc
attgccgagctagaacggcgtggccacgtggtaacccgggccggcgattgggcgctgggt
cgactctcggtggctggaagtgctgacgacggcgttctatacgccgcagcaaatccacgc
ggcatgcaaggctacgccgccgggcgctga

DBGET integrated database retrieval system