KEGG   Rhodoferax saidenbachensis: RS694_01975Help
Entry
RS694_01975       CDS       T04623                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00220  Arginine biosynthesis
rsb00330  Arginine and proline metabolism
rsb01100  Metabolic pathways
rsb01110  Biosynthesis of secondary metabolites
rsb01130  Biosynthesis of antibiotics
rsb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RS694_01975
   00330 Arginine and proline metabolism
    RS694_01975
Enzymes [BR:rsb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RS694_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: APW41440
UniProt: A0A1P8K5Z5
Position
complement(406117..407031)
Genome map
AA seq 304 aa AA seqDB search
MNTRISLIGAPTDIGAGSRGASMGPEALRVAQIASALEGRGLEVLDRGNLTGPNNPWLPP
VDGYRHLAEVTAWNQSLHDAVYAELQLGRLPIVLGGDHCLGIGSISAVARHCRDTGKKLR
VLWLDAHADFNTNTLTPSGNIHGMPVACLCGHGPQQLIEIGGHVPAISPKWVRQIGIRSV
DEGEKRFVHEQDLEVFDMRYIDEMGMRAAMELALALTDANTHLHVSFDVDFLDPDIAPGV
GTTVRGGPNYREAQLCMEMIADTGRLASLDVMELNPALDERNRTALVAVDLIESLFGKST
LMRK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacgcatcagcctgataggcgcacccaccgacattggcgcgggcagccgcggc
gccagcatggggcccgaagccctgcgtgtggcccagatcgccagtgcgctggaagggcgc
ggcctggaagtgctggaccgcggcaacctcaccggccccaacaacccctggctgccgccg
gtcgacggctaccgccatctggccgaggtgacggcgtggaaccagtcgctgcacgatgcg
gtgtatgccgagttgcaactgggacgcctgcccatcgtgctgggtggtgaccactgcctg
ggcattggctccatcagtgccgtggcgcgccactgccgtgacacgggcaagaagctgcgg
gtgttgtggctcgatgcgcatgctgacttcaacaccaacaccctcacgcccagcggcaac
attcacggcatgccggtggcctgcctgtgtgggcacgggccacaacagctcatcgaaatc
ggcggccacgtgccagcgatttcacccaagtgggtgcgccagatcggcatccgcagcgtg
gacgagggcgagaaacggtttgtgcacgagcaagacctggaagtctttgacatgcgttac
atcgacgagatgggcatgcgtgcggccatggagctggccctggcactgaccgatgccaac
acgcatttgcatgtgagctttgacgtggactttctggaccccgacatcgccccgggtgtg
ggcaccaccgtgcgcggcggccccaattaccgcgaagcgcagctctgcatggagatgatt
gccgacaccggccgcctggcctcactcgacgtgatggaactcaaccctgcactggacgaa
cgcaaccgcacggcgctggtcgccgtggatttgatcgaatcattgttcggcaagagcacc
ctgatgcgtaagtga

DBGET integrated database retrieval system