KEGG   Rhodoferax saidenbachensis: RS694_03270Help
Entry
RS694_03270       CDS       T04623                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00071  Fatty acid degradation
rsb00072  Synthesis and degradation of ketone bodies
rsb00280  Valine, leucine and isoleucine degradation
rsb00310  Lysine degradation
rsb00362  Benzoate degradation
rsb00380  Tryptophan metabolism
rsb00620  Pyruvate metabolism
rsb00630  Glyoxylate and dicarboxylate metabolism
rsb00640  Propanoate metabolism
rsb00650  Butanoate metabolism
rsb00900  Terpenoid backbone biosynthesis
rsb01100  Metabolic pathways
rsb01110  Biosynthesis of secondary metabolites
rsb01120  Microbial metabolism in diverse environments
rsb01130  Biosynthesis of antibiotics
rsb01200  Carbon metabolism
rsb01212  Fatty acid metabolism
rsb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RS694_03270
   00630 Glyoxylate and dicarboxylate metabolism
    RS694_03270
   00640 Propanoate metabolism
    RS694_03270
   00650 Butanoate metabolism
    RS694_03270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RS694_03270
   00072 Synthesis and degradation of ketone bodies
    RS694_03270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RS694_03270
   00310 Lysine degradation
    RS694_03270
   00380 Tryptophan metabolism
    RS694_03270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RS694_03270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RS694_03270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RS694_03270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsb04147]
    RS694_03270
Enzymes [BR:rsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RS694_03270
Exosome [BR:rsb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RS694_03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: APW41662
UniProt: A0A1P8K6N0
Position
683416..684597
Genome map
AA seq 393 aa AA seqDB search
MSDSIVITGAARTPMGGFQGDFSSLAAHDLGGAAIKAAIERAGIAPELVTEVLFGNCLMA
GQGQAPARQAAFKGGLPKSAGAVTLSKMCGSGMRAAMFAHDMLLAGSHDVLVAGGMESMT
NAPHLLLKGRSGIRIGHDRVMDHMMLDGLEDAYEAGRSMGTFGEDCAAKYSFTREQQDNF
ATASVQRAQAAIKSGAFEAEITPVTVKTRSGEEQISVDEGPGKIKLEKIPTLKAAFKKDG
TITAASSSSINDGAAALVMMRASTAQTLGSTPLAKIVAHTTHAQEPNWFATAPVGAVQKL
LAKAGWKVEDVDLWEINEAFAVVPMALMKELNIPHDKVNVNGGACALGHPIGASGARIMV
TLIHALKARGLKKGVATLCIGGGEATAVALELL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattccatagttatcaccggcgccgcccgcacccccatgggcggctttcagggc
gacttctcgtcgctcgcagcccacgacctgggtggtgccgccatcaaggccgccatcgag
cgcgcgggcattgcgcctgagttggtgaccgaagtgctcttcggcaactgcctgatggcc
ggccagggccaggcgcctgcgcgccaggcggcgttcaaaggcggcctgcccaagagcgcg
ggtgcggtcacgctgtccaagatgtgcggctccggcatgcgcgcagcgatgttcgcgcac
gacatgctgctggcgggcagccacgatgtgctggtggccggcggtatggaaagcatgaca
aacgcaccgcacctgctgctcaaagggcgcagcggtatccgtatcggacacgaccgcgtg
atggaccacatgatgctcgacggtcttgaggacgcctacgaagccggccgttccatgggc
accttcggcgaagactgcgccgccaagtacagcttcacccgcgaacaacaggacaatttc
gccacagccagtgtgcagcgtgcgcaagcagctatcaaatcaggagcgtttgaggcggag
atcacacccgtcaccgtcaagacccgctccggcgaagaacaaatcagcgtggacgaaggc
cccggcaagatcaagcttgagaagatccccacgctgaaagccgcgttcaagaaagacggc
accatcaccgccgcctccagcagctcgatcaacgacggcgctgccgcgctggtgatgatg
cgcgcctctactgcccagacgctgggtagcacgccactggccaaaatcgtcgcccacacc
acccacgcgcaagagcccaactggtttgccaccgcccccgtcggcgcggtgcaaaagctg
ctggccaaggccggctggaaggtggaagacgtggacctgtgggaaatcaacgaagccttc
gccgtggtgcccatggcgctgatgaaagagctgaacattccgcacgacaaggtcaacgtg
aatggtggtgcctgcgcgctgggccacccgattggcgcgtctggtgcgcgcatcatggtg
acgctgattcacgctttgaaggcgcgtggcttgaagaagggcgtggcgacgctgtgcatc
ggcgggggtgaggcaacggcggtggcactggagttgctttga

DBGET integrated database retrieval system