KEGG   Rhodoferax saidenbachensis: RS694_06990Help
Entry
RS694_06990       CDS       T04623                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00260  Glycine, serine and threonine metabolism
rsb01100  Metabolic pathways
rsb01110  Biosynthesis of secondary metabolites
rsb01120  Microbial metabolism in diverse environments
rsb01130  Biosynthesis of antibiotics
rsb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RS694_06990
Enzymes [BR:rsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RS694_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: APW42309
UniProt: A0A1P8K8K3
Position
complement(1454164..1455240)
Genome map
AA seq 358 aa AA seqDB search
MTTTFQLTPTRQQFASDNYAGTCPEAMHWFMEANASGHEPAYGDDRWTQRSTDMLRTLFD
IECDVYFVFNGTAANSLALASLCQSYHSVICSPVAHIETDECGGPEFFSNGSKLMVAEGQ
SESARLGKLTPDAVSALVTKRSDIHYPRPKVVSITQATEMGTVYTVEEVRAIANAAKKHQ
LKVHMDGARFANAVAHLGCAPADITWRAGVDVLCFGGTKNGLPVGEAVVFFDKAMSEDFA
YRVKQAGQLASKMRFISAPWVGLLENNVWLRNATHANAMAQRLYHGLQKLPGVSVAHTPE
ANGVFAHLPEAAVHALHAKGWKFYQFIAGGGCRFMCAWDTTEASVDALLADLQAQLKG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacattccaacttacaccaacgcgacagcaatttgccagcgacaactacgcg
gggacctgccccgaggcgatgcactggttcatggaggccaatgccagcggccacgagccg
gcctacggcgatgaccgctggacccagcgctccaccgacatgctgcgcacgctgtttgac
atcgagtgcgacgtgtactttgtgttcaacggcacggcagccaactcgctggcgctggcc
tcgttgtgccagagctaccactcggtgatctgcagcccggtggcgcacatcgagaccgac
gaatgcggtggccccgagttcttctccaacggctccaagctgatggtggcggaggggcag
tcggagagcgcccgcctgggcaaactcacacccgacgcagtaagcgcgctggtgaccaag
cgcagcgacatccattacccgcggcccaaggtggtgtccatcacccaggccacggaaatg
ggcacggtctataccgtggaagaagtgcgcgccattgccaacgccgctaaaaaacaccag
ctcaaagtgcacatggacggcgcgcgttttgccaacgccgtggcgcacctgggctgcgcc
cccgccgacatcacctggcgcgcgggcgtggacgtgttgtgcttcggtggcaccaaaaat
ggcctgcccgtgggcgaagccgtggtgttcttcgacaaggccatgagcgaagactttgcc
taccgcgtcaagcaggctgggcaactggcctccaagatgcgtttcatctccgcgccctgg
gtgggcctgctggaaaacaatgtctggctgcgcaacgcgacccacgccaacgcgatggcg
cagcgcctgtaccacggcctgcaaaagctgcccggcgtgagcgtggcccacacgcccgaa
gccaatggcgtgtttgcccacttgcccgaagcagcagtgcatgccctgcacgccaagggc
tggaagttctaccagttcatcgccggtggtggctgccgcttcatgtgcgcgtgggacacc
accgaggcgtcggtagacgccttgctggcggatctgcaagcccaactcaaaggttga

DBGET integrated database retrieval system