KEGG   Rhodoferax saidenbachensis: RS694_09750Help
Entry
RS694_09750       CDS       T04623                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00071  Fatty acid degradation
rsb00072  Synthesis and degradation of ketone bodies
rsb00280  Valine, leucine and isoleucine degradation
rsb00310  Lysine degradation
rsb00362  Benzoate degradation
rsb00380  Tryptophan metabolism
rsb00620  Pyruvate metabolism
rsb00630  Glyoxylate and dicarboxylate metabolism
rsb00640  Propanoate metabolism
rsb00650  Butanoate metabolism
rsb00900  Terpenoid backbone biosynthesis
rsb01100  Metabolic pathways
rsb01110  Biosynthesis of secondary metabolites
rsb01120  Microbial metabolism in diverse environments
rsb01130  Biosynthesis of antibiotics
rsb01200  Carbon metabolism
rsb01212  Fatty acid metabolism
rsb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RS694_09750
   00630 Glyoxylate and dicarboxylate metabolism
    RS694_09750
   00640 Propanoate metabolism
    RS694_09750
   00650 Butanoate metabolism
    RS694_09750
  Lipid metabolism
   00071 Fatty acid degradation
    RS694_09750
   00072 Synthesis and degradation of ketone bodies
    RS694_09750
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RS694_09750
   00310 Lysine degradation
    RS694_09750
   00380 Tryptophan metabolism
    RS694_09750
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RS694_09750
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RS694_09750
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RS694_09750
Enzymes [BR:rsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RS694_09750
Exosome [BR:rsb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RS694_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APW42785
UniProt: A0A1P8K9X6
Position
2038483..2039772
Genome map
AA seq 429 aa AA seqDB search
MTTIRRVAILGGNRIPFARSNTVYSQASNQEMLTATLQGLVDRFNLHGLRMGDVVAGAVM
KHSRDFNLVRESVLSTTLAPETPAFDIQQACGTGLEAAMLVANKIALGHIECGIAGGVDT
TSDAPIAVNEQMRKILLDASRAKTTGQRLAALARFRPGMLFSPALPRNGEPRTGLSMGEH
AELMAQEWHISREAQDALALQSHEHLARAYADGFFTDLMTPFKGATQDNNLRTGLTLEKL
AALKPVFDKKVAPGKGTLTAGNSTPLTDGASAVLLASEEWAAARNLPVLAYLSFSEVAAV
DFFDKKEGLLMAPAYAVPRMLARANLTLQDFDFYEIHEAFAAQVLCTLDAWKNPTFCKER
LGLDKPLGEIDRTKLNVNGSSLAAGHPFAATGGRIVATLAKLLAQKGSGRGLISICAAGG
QGVVAILER
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatccgtcgcgtcgccattctgggcggcaaccgcattcccttcgcgcgttcc
aacaccgtctactcccaggcctccaaccaggaaatgctcaccgccacgctgcaaggcctg
gtggaccgattcaacctgcacggcctgcgcatgggcgatgtggtggccggcgcggtgatg
aaacattcgcgcgacttcaacctggtgcgcgagagcgtgttgtccaccaccctagcgcct
gaaaccccggctttcgatatccagcaggcctgcggcaccggcctggaagcggccatgctg
gtggccaacaagattgcactgggccacattgagtgcggcattgccggtggcgtggacacc
acgtcggacgcgccgattgccgtgaacgagcagatgcgcaagatcctgctggacgcatcg
cgcgccaagaccacgggccaacgtctggcggccctggcccgttttcgcccgggcatgctg
ttcagccccgcgctgccgcgcaatggcgagccgcgcactggcctgtccatgggcgaacac
gccgaactgatggcacaggagtggcacatcagccgcgaagcgcaggacgcgctggcgttg
caaagccacgaacacctggcgcgtgcctatgccgatggctttttcaccgacctgatgaca
ccgttcaaaggcgccacacaggacaacaacctgcgcaccggcctcacgctggagaagctg
gccgcgctgaagcctgtgttcgacaaaaaagtggcgcccggcaagggcacgctgaccgcc
ggcaactccacaccgctgaccgacggcgcctccgccgtgctgttggccagcgaggaatgg
gccgctgcgcgcaatctgccggtgctggcctacttgagcttcagcgaagtggcggcggtg
gacttctttgacaagaaggaaggtctgctgatggccccggcctacgccgtgccgcgcatg
ctggcccgcgccaacctgacgctgcaggacttcgatttttatgaaatccacgaggccttc
gccgcccaggtgttgtgcacgctggacgcctggaaaaaccccaccttctgcaaggaacgc
ctgggcctggacaagccgctgggagagatcgatcggaccaaactcaacgtcaacggcagc
tcgctggcggctggccatccgtttgccgccaccggcgggcgcatcgtcgctacgctggcc
aaactgctggcgcaaaagggcagtggccgaggcctgatttccatctgcgcggcaggcggg
cagggcgtggtggcgattctggagcgataa

DBGET integrated database retrieval system