KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11040Help
Entry
RCFBP_11040       CDS       T01272                                 

Gene name
metG
Definition
(GenBank) Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS)
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00450  Selenocompound metabolism
rsc00970  Aminoacyl-tRNA biosynthesis
rsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RCFBP_11040 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RCFBP_11040 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsc01007]
    RCFBP_11040 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsc03016]
    RCFBP_11040 (metG)
Enzymes [BR:rsc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RCFBP_11040 (metG)
Amino acid related enzymes [BR:rsc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RCFBP_11040 (metG)
Transfer RNA biogenesis [BR:rsc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RCFBP_11040 (metG)
 Prokaryotic type
   Other AARSs
    RCFBP_11040 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: CBJ42339
UniProt: D8NQZ5
Position
complement(1075017..1077083)
Genome map
AA seq 688 aa AA seqDB search
MSERRILVTSALPYANGPIHIGHMVEYIQTDIWVRFQRMRGHEIYYVGADDTHGTPVMLR
AEKEGITPRQLIERVWTEHKRDFDNFLVSFDNYYSTDSDENRELCERVYLKLKEADLIDV
REVEQFYDPVKEMFLPDRFIKGECPKCGAKDQYGDSCEVCGATYQPTDLKNPYSVVSGAT
PVRKSSEHYFFKLSDPRCETFLREWVADLAQPEATNKMREWLGDEGESTLSDWDISRDAP
YFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCGKLGLDFDAWVSTHSTAEQYHFIGKDIL
YFHTLFWPAMLQFSGYRTPTNVFAHGFLTVDGAKMSKSRGTFITAQSYIDTGLNPEWLRY
YFAAKLNATMEDLDLNLDDFIARVNSDLVGKFVNIASRSAGFLVKRFEGRVNDAALGNPL
MVQLREAAPQIADLYEKREYSKALRAVMELADAVNAYVDTEKPWDLAKDEAQRDKLHAAC
SVALEAFRLLAVYLKPILPSTVARIEAFLNVEPLNWRAIDAQLSSARPIQPYSHLMTRVD
KKQVDALVEANRQSLQATVDAVPAANGTPAIEPMAETIAIDDFAKIDLRVAKIVACQRVE
GSNKLLQLTLDVGEGKTRNVFSGIQSAYAPEDLVGKLTVMVANLAPRKMKFGMSEGMVLA
ASAADEKALPGLYILEPHAGAVPGMRVR
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacgtcgcatcctcgtcacctccgccctgccctacgccaacggaccgatccac
atcggccacatggtcgagtacatccagaccgacatctgggtgcgctttcagcgcatgcgc
gggcacgaaatctattacgtgggcgccgacgacacgcacggcacgcccgtcatgctgcgc
gcggaaaaggaaggcatcaccccgcgccagctgatcgagcgcgtctggaccgagcacaag
cgcgatttcgacaacttcctggtctcgttcgacaactactacagcaccgactccgacgag
aaccgcgagctgtgcgagcgcgtctacctcaagctcaaggaagcggacctgatcgacgtg
cgcgaggtcgagcagttctacgacccggtcaaggaaatgttcctgccggaccgcttcatc
aagggcgaatgcccgaagtgcggcgccaaggaccaatacggcgactcctgcgaggtgtgc
ggcgcgacctaccagccgaccgacctgaagaacccgtattcggtggtgtcgggcgccacg
ccggtacgcaaatcctcggagcattacttcttcaagctgtccgacccgcgctgcgagacc
ttcctgcgcgaatgggtggccgacctggcccagcccgaggccaccaacaagatgcgcgaa
tggctgggcgacgaaggcgaatcgacgctgtcggactgggacatctcgcgcgatgcgccg
tacttcggcttcgagattcccggcgcgccgggcaagtacttctacgtgtggctggatgcg
ccggtcggctactacgccagcttcaagaacctgtgcggcaagctgggcctcgacttcgac
gcgtgggtgtccacgcactcgaccgccgagcagtaccacttcatcggcaaggacatcctg
tatttccacacgctgttctggccggcgatgctgcagttctcgggctaccgcacgcccacc
aacgtgttcgcgcacggcttcctgacggtggacggcgccaagatgagcaagtcgcgtggc
acctttatcaccgcgcagagctacatcgacaccggcctgaacccggaatggctgcgctac
tacttcgccgccaagctcaatgcgacgatggaagacctggacctgaacctggacgacttc
atcgcgcgcgtgaacagcgacctggtcggcaagttcgtcaacatcgccagccgctcggcg
ggcttcctggtcaagcgcttcgagggccgcgtgaacgatgccgcgctgggcaacccgctg
atggtccagctgcgcgaggccgcgccgcagatcgccgacctgtacgagaagcgcgagtac
agcaaggccctgcgcgcggtgatggagctggccgatgccgtgaacgcctacgtcgacacc
gagaagccgtgggacctggccaaggacgaagcccagcgcgacaagctgcacgccgcgtgc
tcggtggcgctggaggcattccgcctgctggcggtctatctcaagccgatcctgccgagc
acggtcgcccgcatcgaggcgttcctgaacgtcgaaccgctgaactggcgcgcgatcgat
gcgcagttgtcgtcggcgcgcccgatccagccgtactcgcacctgatgacgcgcgtggac
aagaagcaggtcgatgcgctggtggaggccaaccgccagtcgctgcaagccacggtggat
gcggtcccggccgccaacggcacacccgccatcgaaccgatggccgagaccatcgccatc
gacgatttcgccaagatcgacctgcgcgtggccaagatcgtcgcctgccagcgcgtggag
ggttccaacaagctgctgcagctgacgcttgacgtgggcgaaggcaagacgcgcaacgtc
ttctccggcatccagtcggcctatgcgccggaagacctggtcggcaagctgacggtgatg
gtggccaacctggcgccgcgcaagatgaagttcggcatgtcggaaggcatggtgctggcc
gcctccgccgccgacgagaaggccctgccgggcctgtatatcctcgagccgcatgcgggc
gccgtgcccggcatgcgcgtccgttaa

DBGET integrated database retrieval system