KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11315Help
Entry
RCFBP_11315       CDS       T01272                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00564  Glycerophospholipid metabolism
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
Module
rsc_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RCFBP_11315 (psd)
Enzymes [BR:rsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     RCFBP_11315 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PTS_EIIA_1 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CBJ42612
UniProt: D8NS93
Position
1349415..1350062
Genome map
AA seq 215 aa AA seqDB search
MNNTYPHPIIAREGWPYLGGIFIVTLIVHVAAGMGWAWPFWLLTLFVLQFFRDPARTVPT
QANAILSPADGRIVAVEQVRDPYADRDALKISVFMNVFNVHSNRAPVDGTVQQVQYFPGK
FVNADLDKASLENERNAVVLRRADGQVVTSVQVAGLIARRILCYTRAGETLARGQRYGFI
RFGSRVDVYLPLTARPRVTIGEKVSATLTVLAELD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaacacgtatccgcaccccatcatcgcgcgggagggctggccgtatctgggcgga
atcttcatcgtcacgctcatcgtccacgtcgctgccggcatgggctgggcgtggccgttc
tggttgctgacgctgttcgtgctgcagttcttccgcgatccggcgcgcacggtgccgacg
caggccaacgcgatcctgtcgcctgccgacggtcgcatcgtcgccgtggagcaggtgcgt
gatccgtacgccgatcgcgatgcgctgaagatcagcgtgttcatgaacgttttcaacgtg
cactccaaccgcgcgccggtggacggcaccgtgcagcaggtgcagtacttccccggcaag
ttcgtcaacgccgacctggacaaggcctcgctcgagaacgagcgcaacgccgtggtgctg
cgtcgcgccgatggccaggtggtcacctcggtgcaggtggccgggttgattgcgcgccgc
atcctttgctataccagagccggcgagacgctcgcgcgcggccagcgctacggcttcatt
cgcttcggctcgcgtgtcgacgtgtacctgccgctcacggcgcgcccgcgcgtgaccatc
ggcgagaaggtgtcggccacgctgacggtgctcgctgagctggactga

DBGET integrated database retrieval system