KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11645Help
Entry
RCFBP_11645       CDS       T01272                                 

Gene name
phaA
Definition
(GenBank) acetyl-CoA acetyltransferase, thiolase-like
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00071  Fatty acid degradation
rsc00072  Synthesis and degradation of ketone bodies
rsc00280  Valine, leucine and isoleucine degradation
rsc00310  Lysine degradation
rsc00362  Benzoate degradation
rsc00380  Tryptophan metabolism
rsc00620  Pyruvate metabolism
rsc00630  Glyoxylate and dicarboxylate metabolism
rsc00640  Propanoate metabolism
rsc00650  Butanoate metabolism
rsc00900  Terpenoid backbone biosynthesis
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01120  Microbial metabolism in diverse environments
rsc01130  Biosynthesis of antibiotics
rsc01200  Carbon metabolism
rsc01212  Fatty acid metabolism
rsc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCFBP_11645 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    RCFBP_11645 (phaA)
   00640 Propanoate metabolism
    RCFBP_11645 (phaA)
   00650 Butanoate metabolism
    RCFBP_11645 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RCFBP_11645 (phaA)
   00072 Synthesis and degradation of ketone bodies
    RCFBP_11645 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RCFBP_11645 (phaA)
   00310 Lysine degradation
    RCFBP_11645 (phaA)
   00380 Tryptophan metabolism
    RCFBP_11645 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCFBP_11645 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RCFBP_11645 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RCFBP_11645 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsc04147]
    RCFBP_11645 (phaA)
Enzymes [BR:rsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RCFBP_11645 (phaA)
Exosome [BR:rsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCFBP_11645 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBJ42936
UniProt: D8NIR4
Position
1696794..1697978
Genome map
AA seq 394 aa AA seqDB search
MAREVVVVSSVRTAVGTFGGSLKDVAPCELGALVVREALARAQVRGEEVGHVVFGHVINT
EPRDMYLSRVAALNGGVPAETPAFNVNRLCGSGLQAVVSAAQTILLGDADVAIGGGAESM
SRAPYLAPAARWGSRMGDAKMIDMMLGALHDPFHAIHMGVTAENVAREYGISRELQDRTA
LESHQRASHAIRAGYFKDQIVPVTIPSRKGDVRFDTDEHVRHDATIDDMTRLKPVFAKES
GTVTAGNASGLNDAAAALVLMERSLAEQRGLKPLARLVSYGHAGVDPKVMGIGPVPATRK
ALERAGLTVKDLDVVEANEAFAAQACAVTQQLGLDPAKVNPNGSGISLGHPIGATGALIT
VKALHELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtgaagtggtggtggtcagcagtgtgcgcaccgcagtcgggacgttcggcggc
agcctgaaggacgtggcgccgtgcgagctgggcgcgttggtggtgcgcgaggcgctggcg
cgcgcccaggtccggggcgaggaggtcggccacgtggtgttcggccacgtcatcaacacc
gagccgcgcgacatgtacctgtcgcgcgtggctgccctgaacggcggcgtgccggccgaa
acgcccgcgttcaacgtcaaccgcctgtgcggctccggcctgcaggccgtggtgagtgcc
gcgcagaccattctgctgggcgatgccgacgtcgccatcggcggcggcgccgagagcatg
agccgcgctccgtacctggcgcccgcggcccgctggggttcgcgcatgggcgacgccaag
atgatcgacatgatgctcggcgcgctgcacgacccgttccacgccatccacatgggcgtg
acggcggaaaacgtcgcccgggaatacggcatcagtcgcgagctgcaggaccggactgcg
ctggaatcgcaccagcgcgcgtcgcacgccatccgggccggctacttcaaggaccagatc
gtcccggtgacgattccgtcgcgcaagggcgacgtgcggttcgataccgacgaacacgtc
cgccatgacgcgaccatcgacgacatgaccaggctcaagccggtcttcgccaaggaaagc
ggcacggtgacggcgggcaacgcctcgggcctgaacgatgcggccgcggccctggtgctg
atggagcgctcgctggccgaacagcgcggcctgaagccgctggcgcggctggtgtcgtac
ggccacgcgggcgtggacccgaaggtgatgggcatcggcccggtgccggcaacacgcaag
gcgctggagcgcgccggcctgacggtcaaggacctagacgtggtcgaggccaacgaggcc
ttcgctgcgcaggcctgcgcggtgacacagcaactgggcctggacccggccaaggtcaac
ccgaacggctcgggcatctcgctcggccatccgatcggcgcgaccggtgccctgattacg
gtgaaggcgctgcacgaactgcagcgcatcggtggtcgctacgcgctggtgaccatgtgc
attggtggaggacaaggcattgccgcggtgttcgaacgtctctga

DBGET integrated database retrieval system