KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11771Help
Entry
RCFBP_11771       CDS       T01272                                 

Definition
(GenBank) putative acyl-coA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00071  Fatty acid degradation
rsc00280  Valine, leucine and isoleucine degradation
rsc00410  beta-Alanine metabolism
rsc00640  Propanoate metabolism
rsc00650  Butanoate metabolism
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01120  Microbial metabolism in diverse environments
rsc01130  Biosynthesis of antibiotics
rsc01200  Carbon metabolism
rsc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RCFBP_11771
   00650 Butanoate metabolism
    RCFBP_11771
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RCFBP_11771
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RCFBP_11771
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RCFBP_11771
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     RCFBP_11771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M AcylCoA_DH_N Acyl-CoA_dh_2 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: CBJ43060
UniProt: D8NJ38
Position
1819652..1821520
Genome map
AA seq 622 aa AA seqDB search
MSSLLLSRRDLSFLLYEWLDVEALTRFPRYADHSRETFDAALDTCERIATDLFAPHNKKN
DQQEPHFDGTTVHLIPEVKTALAAFNKAGLMAAGQDFERGGMQLPTVVEKAGFGYFKAAN
VGTSAYPFLTIGNANLLLAHGTPAQIEAFAQPELEGRFYGTMCLSEPQAGSSLSDIVTRA
EYEGASPLGPQYRLTGNKMWISAGEHALSDNIVHLVLAKIPGPDGKPIPGVKGISLFIVP
KFLVNADGSLGERNDVALAGLNHKMGYRGTTNCLLNFGEGTQFRPRGPDGQPCAGAIGYL
VGEPHKGLACMFFMMNEARIGVGMGATMLGYTGYLHALDYARNRPQGRPVGPSGKDAASP
QIRIVDHADVRRMLLAQKAYVEGALGLNLYCAKLVDEERGETDPAVRARLGLLLDILTPI
AKSWPSQWCLEANSLAIQVHGGYGYTREYNVEQFYRDNRLNPIHEGTHGIHGLDLLGRKV
VMQDGAAFAALGERVQASVGRALECGDEALPGYGRALGMAAQRLAKVTQTLWAAGDPRVT
LANASVYLEAFGHVVIAWIWLEQALAAAKALPNAQGEAADFYRGKLQAARYFFQWELPKI
DPQLALLASLDTATLDMQDAWF
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctctgctgctgtcgcgtcgcgacctgagctttctgctctatgaatggctcgat
gtggaggcgctcacgcgctttccgcgctatgccgaccactcccgcgaaaccttcgacgcg
gcgctcgatacctgcgagcgcatcgccaccgatctgttcgcgccgcataacaagaagaac
gaccagcaggagccgcacttcgacggcaccacggtccacctcattcccgaggtcaagacg
gcgctggcggccttcaacaaggcgggcctgatggccgcggggcaggatttcgagcgcggc
ggcatgcagttgcccaccgtggtcgagaaggccggcttcggctacttcaaggcggccaat
gtcggcaccagcgcctatccgttcctgaccatcggcaatgccaacctgctgctggcgcac
ggcacgccggcgcagatcgaggcctttgcgcagcccgagctggaggggcgcttttacggc
acgatgtgcctgtcggagccgcaggcgggctcgtcgctgtcggacatcgtcacgcgcgcc
gaatacgaaggcgcatcgccgctggggccgcagtaccggctgaccggcaacaagatgtgg
atctccgccggcgagcacgccttgtcggacaacatcgtgcatctcgtgctggccaagatt
cccggcccggacggcaaaccgatcccgggcgtcaagggcatctcgctgttcatcgtgccc
aagttcctcgtcaacgcggatgggtcgctgggcgagcgcaacgacgtggcgctcgccggc
ctgaaccacaagatgggctatcgcggcaccaccaactgcctgctgaacttcggcgaaggc
acgcagttccgcccgcgggggccggatggacagccgtgcgccggtgccatcggctatctg
gtcggcgagccgcacaaggggctggcgtgcatgtttttcatgatgaacgaggcgcgcatc
ggtgtcggcatgggggcgaccatgctgggctataccggctacctgcatgcgctggactac
gcgcgcaaccgtccgcagggccggccggtcggcccgtccggcaaggacgccgcatcgccg
cagatccgcatcgtcgaccacgccgacgtgcgtcgcatgctgctggcgcagaaggcctac
gtggagggcgcgctcggcctgaacctgtattgcgccaagctggtcgacgaggaacgcggc
gagacggatcccgccgtgcgcgcccggctcggcctgctgctcgacatcctcacgccgatc
gccaagagctggccgtcgcagtggtgcctggaggccaacagcctggcgatccaggtgcac
ggcggctacggctacacgcgcgagtacaacgtcgagcagttctaccgcgacaaccgcctg
aacccgattcacgaaggcacgcacggcatccacgggctggacctgctcggccgcaaggtg
gtgatgcaggacggcgccgcctttgctgcgttgggcgagcgcgtacaggcgagcgtcggc
cgtgcgctggaatgtggcgatgaagccctgcccggttacggccgcgcgctcggcatggct
gcgcaacgtctggccaaggtcacgcagacgctgtgggcggcgggcgacccgcgcgtgacg
ctcgccaatgcctcggtgtatctggaggctttcggccacgtcgtcatcgcatggatctgg
ctggaacaggcccttgccgccgcaaaagcgttgccgaacgcgcagggagaggccgccgat
ttctatcgcggcaagctgcaggccgcacgctatttcttccagtgggagttgccgaagatc
gacccgcaactggcattgctggcctcgctcgacaccgccacgctggacatgcaggacgcc
tggttctga

DBGET integrated database retrieval system