KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20885Help
Entry
RCFBP_20885       CDS       T01272                                 

Definition
(GenBank) putative Glutamyl-tRNA amidotransferase/amidase (gatA)
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00970  Aminoacyl-tRNA biosynthesis
rsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RCFBP_20885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rsc03029]
    RCFBP_20885
Enzymes [BR:rsc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RCFBP_20885
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RCFBP_20885
Mitochondrial biogenesis [BR:rsc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RCFBP_20885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CBJ44065
UniProt: D8NP15
Position
2823589..2824935
Genome map
AA seq 448 aa AA seqDB search
MMTPRPDMIRALAAELAAGRTTSVALTEAALAHAQAHRAADGAAYVSLDARAALDMARAA
DAARAAGNVPSLLAGLPVSIKDLFDVAGQVSAAGSRALAHQPPATADAVAVARLRAAGAV
LLGRTNMSEFAFSGLGLNPHYGTPRTPADGTRAAGGSTSGGAVTVAGGMAVAALGTDTGG
SIRIPAAFCALTGFKPTARRVPMAGGVPLSTSLDSGGPLANSVDCCAIVDAVLSGQALDT
DAVPLAGLRLGLTRDYVGADLDDTVATAFQRAVMRLEQAGARIVRFDFPELLQLPEINGG
GGLPAAESWAWHRPHLARAEAQYDRRVAARIRRGEQMTAAAYLDVMAARERMIAAARKRL
GNLDAWLMPTVAIVPPEVAPLEADDTQFFRTNALVLRNPSVINFLDGCALTLPIHGAGEL
PVGLSLCGLADDDARILRVGRAVEAALR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaccccgccccgacatgatccgcgccctggccgccgagctggccgccggccgc
accaccagcgtcgcactgaccgaagccgcgctggcgcacgcgcaggcgcaccgcgcggcc
gatggcgcagcctacgtcagcctcgacgcgcgggctgcgctggacatggcgcgtgccgcc
gatgccgcgcgcgcggcgggcaacgtgccgtcgctgctggcagggctgccggtgtcgatc
aaggatctgttcgatgtggcgggacaggtgagcgccgccggctcgcgcgcgctggcgcac
cagccccccgccaccgcagacgcggtcgccgtggcgcggctgcgcgcggccggggcggtg
ctgctcggccgcaccaacatgagcgaattcgcgttctccggcctgggcctgaacccgcac
tacggcacgccgcgcacgccggcagacggcacacgcgccgcgggcggctcgacctccggc
ggcgcggtgacggtggccggcggcatggccgtcgccgcgctgggcaccgacaccggcggc
tcgatccgcattccggcggcgttctgcgcgctgaccggcttcaagcccaccgcgcgccgc
gtgccgatggccggcggcgtgccgctgtccacctcgctcgattcgggcgggccgctggcc
aactcggtggactgctgcgccatcgtcgatgccgtcctcagcggccaggcgctcgatacc
gacgccgtgccgctggcgggcctgcgcctgggactcacgcgcgactatgtgggcgcggac
ctggacgacaccgtggccaccgccttccagcgcgccgtgatgcggctggaacaggcgggc
gcgcgcatcgtccgcttcgattttcccgagctgctgcaactgcccgagatcaacggcggg
ggcggcctgccggcggccgagtcctgggcctggcaccgtccgcacctggcgcgcgccgaa
gcgcaatacgatcgccgcgtggccgcgcgcatccgccgcggcgagcagatgaccgccgct
gcctacctcgacgtgatggcggcgcgcgagcgcatgatcgccgccgcgcgcaagcggctg
ggcaacctcgacgcttggctgatgccgaccgtcgccatcgtgccgccggaagtggcaccg
ctggaggccgacgacacgcagttcttccgcaccaacgcgctggtgctgcgcaacccgagc
gtgatcaatttcctggacggctgcgcgctgacgctgcccatccatggcgccggcgagctg
ccggtcgggctgtcgctgtgcggcctggccgacgacgatgcgcgcatcctgcgtgtcggg
cgggcggtggaggccgcactgcgctga

DBGET integrated database retrieval system