KEGG   Ralstonia solanacearum CFBP2957: RCFBP_21352Help
Entry
RCFBP_21352       CDS       T01272                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00670  One carbon pool by folate
rsc01100  Metabolic pathways
rsc01120  Microbial metabolism in diverse environments
rsc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RCFBP_21352 (metF)
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     RCFBP_21352 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: CBJ44526
UniProt: D8NRI1
Position
3308538..3309386
Genome map
AA seq 282 aa AA seqDB search
MSAPFVMQDRQFSFEFFPPKTAEGAEKLRNTRAQLSPLKPRFISVTFGAGGTTQQGTLDA
VVEIQREGIEAAPHLSCVGSSRESIRSILDTYREHGIRRLVALRGDLPSGMGEIGEFRFA
NELVEFVRKEMNDTFHIEVAAYPEYHPQARSSRQDLENFARKVKAGANSAITQYFFNADA
YFQFVDDARKLGVDVPIVPGIMPITNSSQLMRFSEMCGAEIPRWIAKRLESFGDDRESIR
AFGLDVVTALCDRLLAGGAPGLHFYTLNAAAATRAIWQRLGL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcccctttcgtcatgcaagaccgtcaattcagtttcgaattcttcccgcccaag
acggcggaaggcgccgagaagctgcgcaacacgcgcgcgcagctcagccccctcaagccg
cgcttcatttccgtgaccttcggcgcgggcggcactacgcagcagggcacgctcgacgcc
gtggtggagatccagcgcgaaggcatcgaggccgcgccgcacctgtcgtgcgtgggctcg
tcgcgcgagagcatccgcagcatcctcgacacctatcgcgaacacggcatccgccgcctc
gtcgcgctgcgcggcgacctgccgtcgggcatgggcgagatcggcgaattccgcttcgcc
aacgagctggtcgagttcgtccgcaaggagatgaacgacaccttccacatcgaggtggcg
gcgtatcccgaataccatccgcaggcgcgctcgtcgcgccaggacctggagaacttcgcc
cgcaaggtgaaggccggcgccaactccgccatcacgcaatatttcttcaacgccgacgcc
tacttccagttcgtcgacgacgcgcgcaagctgggcgtggacgtgccgatcgtgccgggc
atcatgccgatcacgaattcgtcgcagctgatgcgcttctcggagatgtgcggcgcggag
atcccgcgctggatcgccaagcgcctggagagcttcggcgacgaccgcgaatcgatccgc
gccttcggcctggacgtggtgacggcgctgtgcgaccggctgctcgcgggcggcgcgccg
ggcctgcacttctacacgctcaacgcggccgccgccacgcgcgcgatctggcagcggctg
gggctgtaa

DBGET integrated database retrieval system