KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_122Help
Entry
TGRD_122          CDS       T00755                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
rsd00260  Glycine, serine and threonine metabolism
rsd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsd01100  Metabolic pathways
rsd01110  Biosynthesis of secondary metabolites
rsd01130  Biosynthesis of antibiotics
rsd01230  Biosynthesis of amino acids
Module
rsd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGRD_122
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TGRD_122
Enzymes [BR:rsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TGRD_122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA Dus DUF561
Motif
Other DBs
NCBI-ProteinID: BAG13605
UniProt: B1GZC3
Position
180925..181737
Genome map
AA seq 270 aa AA seqDB search
MNNIRSSTAASKSRWLITEIFKNGKALITYLTAGDPSLDKTEDYILTMAENGSDLIEIGI
PFSDPVAEGETIQNAMTRALSKNIDLDDIFNVVENVRKKSNVPLVFMTYLNPLFSYGYEK
FFKKCASTGINGIIVPDMPFEEQEEIKSFTDKYDITIITLIAPTSKERISVLAKQAEGFI
YLVSSLGVTGVRSRITTNIDAIVSEIKKVTDTPVAVGFGISTPEQAKKVTKSADGVIIGS
AVVKIIAEYKESAASKLAEYVSEIKRVMQD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatccgttcttctactgctgcctcaaaaagcaggtggcttatcacagaaata
tttaaaaatggaaaggctctgataacatatcttacggctggagatccgtctcttgataaa
actgaagactacattttgacaatggctgaaaatggatctgatttaatagaaataggcata
cctttttcggatcctgtggcagagggtgagacgatacaaaatgcaatgacaagagcattg
tcaaaaaatatagatttagatgatatttttaatgttgttgaaaacgtccgaaaaaagtca
aatgttccgcttgtatttatgacgtatttaaatcctttgttttcttatggatatgaaaag
ttttttaaaaagtgcgccagtacgggaataaacggcataattgttccagatatgcctttt
gaagagcaggaggaaatcaaaagttttactgataaatacgacataacgattattacgctc
atagctcctacgtctaaagagagaataagtgttttggcaaagcaggcggaaggttttata
tatcttgtttcatcgcttggcgttacgggagtgagaagcaggataaccaccaatattgac
gctatagtctctgaaataaagaaagtgacggatacgcctgttgctgtaggatttgggatt
tctactcccgagcaggcaaaaaaagtgacaaagtctgccgacggtgtgataataggaagc
gctgttgtaaaaataattgcagagtataaagaaagcgccgcttccaaacttgcggaatat
gtttcagaaatcaagagagttatgcaggactga

DBGET integrated database retrieval system