KEGG   Ralstonia solanacearum FQY_4: F504_1571Help
Entry
F504_1571         CDS       T02751                                 

Definition
(GenBank) Methionyl-tRNA synthetase-related protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00450  Selenocompound metabolism
rse00970  Aminoacyl-tRNA biosynthesis
rse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    F504_1571
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F504_1571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rse01007]
    F504_1571
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rse03016]
    F504_1571
Enzymes [BR:rse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     F504_1571
Amino acid related enzymes [BR:rse01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   F504_1571
Transfer RNA biogenesis [BR:rse03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    F504_1571
 Prokaryotic type
   Other AARSs
    F504_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 zf-RING_7
Motif
Other DBs
NCBI-ProteinID: AGH84086
UniProt: M4UEN9
Position
complement(1659669..1661159)
Genome map
AA seq 496 aa AA seqDB search
MKARKTYVLIPVMPTPNGPLHLGHIAGPFLKMDMLARHLRRNGNTVALVSATDPYETHVL
PRADEQHKPVEQICAENHRAIHRCLQALDIRYDAFIDPLASPYRARLNGITREVLDDLHA
QGRLHARNEPVHISRRTGRMLVGSRIVGTCPCCGVEMGGYHCEGCGMEVSPRDLIAPRAE
PADDTVEVEARASVFVDADLPALQRRMLEARVPADVRRIAERFMHAAGSAVRLSNPGEWG
EIWPNTLATAPSVVFSYTALFMLSVLCGEAAREILALDHNPFDRRSDALIVTSFGFDNTV
PFCVGVETLAQHSRRYRGFDRCLTNFFYTLDGRKFSTSRQHCIWADQAVRELGVASDVLR
YFLAKTSPESGPSDFSRDGFDAFRRAIEPRLAQMKAAVESGIGGDAAVPYADTLARLVAD
MDAAFDVDHFSLRAATRCIDQWLALPWQPAHAAAYVRGFCMLAYPVMPELASTLWSQLGH
EGLPRYLAATELEEAA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcgcaaaacgtacgtgctcattccggtgatgccgacaccgaatggcccactg
catcttggccacatcgcgggcccgttcctcaagatggacatgctcgcgcggcatctgcgg
cgcaacggcaacacggtcgcgctggtctccgcgacggatccttatgagacccatgtgctg
ccccgcgccgacgaacagcacaagcccgtcgagcagatctgcgccgaaaaccatcgggcg
attcaccgttgcctgcaggcactcgacattcgctacgatgcttttatcgatccgctcgca
tcgccgtaccgggcacgcctgaacggcattacgcgcgaagtgctcgacgacctgcatgcg
cagggacggctgcacgcgcgcaacgagccggtccacatcagccgccgaaccgggcggatg
ctcgtcggcagccggatcgtcggcacgtgtccgtgttgcggcgtcgaaatgggcggctac
cattgcgaagggtgcggaatggaggtctcgccccgcgacctgatcgccccgcgcgccgaa
ccggcggacgacacggttgaggtggaagcgcgggccagtgttttcgtcgacgccgatctc
cccgcgctccagcggcggatgctcgaagcgcgggtgccggccgacgtccgccgcatcgcc
gaacggttcatgcatgcagcgggcagcgcggtgcggctctcgaacccgggcgaatggggc
gagatctggcccaatacgctggcaaccgcaccatcggtggtgttctcctacacggcgctg
ttcatgctgtcggtactgtgcggcgaggcggcgcgtgaaatcctcgcgctcgaccacaat
ccgtttgatcggcgctccgacgcgctgatcgtcaccagcttcggattcgacaatacggtg
cctttctgcgtgggcgtggagacgctcgcgcaacacagcaggcgctaccgcggcttcgac
cgctgcttgacgaacttcttctacacgctcgacggccggaagttctcgacgagccgccag
cactgcatctgggccgaccaggcggtacgggagctgggcgtggcctcggacgtgctgcgc
tatttcctggccaagaccagcccggaaagcggaccgagcgatttctcgcgcgacggcttc
gacgcgttccggcgcgcgatcgaaccccgcctggcgcagatgaaagccgcggttgaatcc
ggcattggcggcgatgcagccgttccctatgcggacacattggcgcgacttgtcgcggac
atggacgcggctttcgacgtcgatcatttcagcctgcgtgccgcgacacgctgcattgat
caatggctcgcactcccatggcagccggcgcatgccgccgcgtatgtgcgcggcttttgc
atgctggcctatccggtcatgcccgagctggcctcgaccctgtggagccaactcggccac
gaaggcctgcctcgctatctagccgcgaccgaactggaggaagccgcatga

DBGET integrated database retrieval system