KEGG   Ralstonia solanacearum FQY_4: F504_2080Help
Entry
F504_2080         CDS       T02751                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase, type I
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00010  Glycolysis / Gluconeogenesis
rse00030  Pentose phosphate pathway
rse00051  Fructose and mannose metabolism
rse00680  Methane metabolism
rse01100  Metabolic pathways
rse01110  Biosynthesis of secondary metabolites
rse01120  Microbial metabolism in diverse environments
rse01130  Biosynthesis of antibiotics
rse01200  Carbon metabolism
Module
rse_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F504_2080
   00030 Pentose phosphate pathway
    F504_2080
   00051 Fructose and mannose metabolism
    F504_2080
  09102 Energy metabolism
   00680 Methane metabolism
    F504_2080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rse04147]
    F504_2080
Enzymes [BR:rse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     F504_2080
Exosome [BR:rse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F504_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AGH84594
UniProt: M4UEE6
Position
2244912..2245928
Genome map
AA seq 338 aa AA seqDB search
MKRINLTRYLIEEQREHNTIPAELRLLLEVVARACKAISHSVNKGALAGVLGSAGTGNVQ
GETQQKLDVIANEVLLEANEYGGNLAAMASEEMESFYEIPHRYPKGEYLLLFDPLDGSSN
IDVNVSIGTIFSVLHMPKPGQTVTEADFMQPGVRQVAAGYAVYGPQTTLVLTVGNGVHMF
TLDREVGSFILTNRDVKIPADTKEFAINMSNMRHWAPPVRRYIDECLAGTEGPRGKDFNM
RWIASMVADVHRILTRGGIFMYPWDKREPGKAGKLRLMYEANPMAFLVEQAGGAATNGHQ
RILEIQPEKLHQRVAVILGSKNEVDRVTQYHQEAQQTA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcatcaacctcacccgctacctgatcgaagagcagcgcgagcacaacaccatc
cccgccgagctgcgcctgctgctcgaagtcgtggcgcgcgcctgcaaggcgatctcgcac
agcgtcaacaagggcgcgctggccggcgtgctcggctcggccggcacgggcaacgtgcaa
ggcgaaacccagcagaagctggacgtgatcgccaacgaagtcctgctcgaagccaacgag
tacggcggcaacctggccgcgatggcctcggaagagatggagtcgttctacgagatcccc
catcgctatccgaagggcgaatacctgctgctgttcgatccgctcgacggctcgtccaac
atcgacgtgaacgtgtcgatcggcaccatcttctcggtgctgcacatgcccaagccgggc
cagaccgtgaccgaagccgacttcatgcagccgggcgtcaggcaggtcgccgccggctac
gccgtctacggtccgcagaccacgctggtgctcaccgtcggcaacggcgtgcacatgttc
acgctcgaccgcgaagtcggcagcttcatcctgaccaaccgcgacgtgaagattccggcc
gacaccaaggagttcgccatcaacatgtcgaacatgcgccactgggccccgcccgtgcgc
cgctacatcgacgaatgcctggccggcaccgaaggcccgcgcggcaaggacttcaacatg
cgctggatcgcctcgatggtggccgacgtgcaccgcatcctcacgcgcggcggcatcttc
atgtacccgtgggacaagcgcgagccgggcaaggccggcaagctgcgcctgatgtacgaa
gccaacccgatggccttcctggtggagcaggccggcggcgccgccaccaacggccatcag
cgcatcctcgagatccagccggagaagctgcaccagcgcgtggcggtgatcctgggctcc
aagaacgaggtggaccgcgtcacgcagtaccaccaggaagcccagcagaccgcctga

DBGET integrated database retrieval system