KEGG   Ralstonia solanacearum FQY_4: F504_2350Help
Entry
F504_2350         CDS       T02751                                 

Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00860  Porphyrin and chlorophyll metabolism
rse01100  Metabolic pathways
Module
rse_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    F504_2350
Enzymes [BR:rse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     F504_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AGH84863
UniProt: M4UEQ8
Position
complement(2539470..2540957)
Genome map
AA seq 495 aa AA seqDB search
MSTSPFSGPPRGTLMIQGTTSDAGKSTLVAGLCRIAHRAGVRVAPFKPQNMALNSAVTAD
GGEIGRAQALQAQAAGLAPTVDMNPVLLKPNSDTGAQVIIHGRPRGDLNARAYHDYKPTA
MAAVLASHGRLRAQYDLVLVEGAGSPAEVNLRARDIANMGFAEAVDCPVVLVADIDRGGV
FAHLVGTLACLSESERARVTGFVINRFRGDLSLLTPGLDWLTAQTGKPVFGVLPYLQGLH
LDAEDAVQTAQSAASGEVLRVVIPVLPRISNHTDFDALRAHPQVDVRMVGPGRPIPPADL
VILPGSKSVQADLAWLRAHGWDAAIARHLRYGGKLIGICGGMQMLGRRLRDPLGLEGRPG
SLDGLGYLDFETTLAPAKQLRQVRGTLADGGAALAGYEIHMGVTEGPALARPAVRLDDGR
TDGAVSADGQILATYLHGLFDAPEACRALLAWAGVREARAQDYAALREASLERLADTLRA
HLDLPALFASLAVRG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcgccgttttccgggccgccgcgcggcacgctgatgatccagggcaccact
tccgatgccggcaagagcacgctggtggcgggcctgtgccgcatcgcgcatcgcgcgggc
gtgcgcgtggcgccgttcaagccgcagaacatggcgctcaacagcgcggtgacggccgac
ggcggcgagatcgggcgggcgcaggccctgcaggcgcaggccgccggcctggcgcccacg
gtggacatgaatccggtgctgctcaagcccaacagcgacaccggcgctcaggtcatcatc
catggccggccgcgcggcgatctgaatgcgcgcgcctatcacgactacaagccgaccgcg
atggccgccgtgctcgcctcgcacggccgcctgcgcgcgcagtacgacctggtgctggtc
gaaggcgccggcagccccgccgaggtcaacctgcgcgcgcgcgatatcgccaacatgggt
tttgccgaggcggtcgactgcccggtcgtgctggtcgccgacatcgaccgcggcggcgtg
ttcgcgcacctggtcggcacgctggcctgcctgtcggaaagcgagcgcgcgcgcgtgacg
ggcttcgtcatcaaccgctttcgcggcgatctctctctgctgacgcccggcctcgactgg
ctgacggcgcagaccggcaagccggtgttcggcgtgctgccgtatctgcaggggctgcac
ctggatgcggaggatgccgtgcagacggcgcaatccgccgcctcgggcgaggtgctgcgc
gtcgtcatcccggtgctgccgcgcatctccaaccacaccgatttcgatgcgctgcgcgcg
cacccgcaggtcgacgtgcggatggtcgggccgggccggccgatcccgccggcggacctg
gtcatcctgcccggcagcaagagtgtgcaggccgatctcgcctggctgcgcgcgcacggc
tgggatgccgccatcgcgcgccacctgcgctacggcggcaagctgatcggcatctgcggc
ggcatgcagatgctggggcgccggctgcgcgatccgctcgggctggaagggcggccgggg
agcctcgacggcctgggctatctcgatttcgagacgacgctggcacccgccaagcagctg
cggcaggtgcgcggcacgctggcggatggcggcgcggcgctcgccggctacgaaatccac
atgggcgtgaccgagggcccggccctggcgcggcccgccgtccggctcgacgatggccgc
accgatggcgcggtgtccgccgacgggcagatcctcgccacctacctgcacggcctgttc
gacgcgcccgaggcgtgccgcgcgctgctggcctgggcgggcgtgcgcgaggcccgtgcg
caggactacgccgcgctgcgcgaggcctcgctcgagcgcctggccgatacgctgcgggcg
catctcgacctgccggccctgtttgcctcgctggcggttcgcggctga

DBGET integrated database retrieval system