KEGG   Ralstonia solanacearum FQY_4: F504_294Help
Entry
F504_294          CDS       T02751                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00071  Fatty acid degradation
rse00072  Synthesis and degradation of ketone bodies
rse00280  Valine, leucine and isoleucine degradation
rse00310  Lysine degradation
rse00362  Benzoate degradation
rse00380  Tryptophan metabolism
rse00620  Pyruvate metabolism
rse00630  Glyoxylate and dicarboxylate metabolism
rse00640  Propanoate metabolism
rse00650  Butanoate metabolism
rse00900  Terpenoid backbone biosynthesis
rse01100  Metabolic pathways
rse01110  Biosynthesis of secondary metabolites
rse01120  Microbial metabolism in diverse environments
rse01130  Biosynthesis of antibiotics
rse01200  Carbon metabolism
rse01212  Fatty acid metabolism
rse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F504_294
   00630 Glyoxylate and dicarboxylate metabolism
    F504_294
   00640 Propanoate metabolism
    F504_294
   00650 Butanoate metabolism
    F504_294
  09103 Lipid metabolism
   00071 Fatty acid degradation
    F504_294
   00072 Synthesis and degradation of ketone bodies
    F504_294
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F504_294
   00310 Lysine degradation
    F504_294
   00380 Tryptophan metabolism
    F504_294
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F504_294
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F504_294
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F504_294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rse04147]
    F504_294
Enzymes [BR:rse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F504_294
Exosome [BR:rse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F504_294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: AGH82816
UniProt: M4UAY7
Position
complement(313052..314233)
Genome map
AA seq 393 aa AA seqDB search
MSDRIIIASAARTPMGAFQGELASLTAPQLGATAIRAAVERAGLKPEQIEEVIMGCVLPA
GQGQAPARQAALGAGLPLSVGCTTVNKMCGSGMRAAMNAYDALLAGSVDVVVAGGMESMT
NAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGTFGEDCAEKYGFTREAQDAF
AMDSVRRAQAATESGAFRWEIAPVTVPGKAGDTVVDTDEGPRRIKVDKIPSLKPAFKKDG
TVTAASSSSINDGAAALVMMRESTARQLGIAPLAVMLGHTTHAQAPGWFTTAPVTAIDKL
FKKLGWSADSVDLFEINEAFAVVPMAAMHDLRIPHEKVNVNGGACALGHPIGASGARLIA
TLLGALRHRGGKRGVASLCIGGGEATAVGIELL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccgcatcatcatcgcctccgccgcccgcacccccatgggcgctttccagggc
gagctcgccagcctgaccgcgccgcagctcggcgcgaccgccatccgcgcggcggtggag
cgcgcgggcctgaagcccgagcagatcgaggaggtcatcatgggctgcgtgctgccggcc
ggccagggccaggcgccggcgcgccaggcggcgctgggcgcgggcctgccgctgtcggtg
ggctgcacgacggtcaacaagatgtgcggctcgggcatgcgcgcggcgatgaacgcctac
gacgcgctgctggccggatcggtggacgtggtggtggccggcggcatggagagcatgacc
aacgcgccctacctgatcccgaagggccgcggcggctaccgcatcggccacggcatgatc
tacgaccacatgatgctcgacggcctggaagacgcctatgacaagggccgcgccatgggc
accttcggcgaggactgcgccgagaagtacggcttcacgcgcgaggcgcaggatgccttc
gcgatggactccgtgcggcgcgcgcaggcagccaccgaatcgggcgcgttccgctgggag
atcgcgccggtgacagtgccgggcaaagccggcgacaccgtggtcgacaccgacgaaggc
ccgcgccgcatcaaggtcgacaagattccctcgctcaagcccgcgttcaagaaggacggc
acggtgacggccgcttcgtcctcgtcgatcaacgacggcgccgccgcgctggtgatgatg
cgggaatcgaccgccaggcagctcggcatcgcgccgctggcggtcatgctgggccacacc
acgcacgcgcaggcgcctggctggttcaccaccgcgccggtcacggcgatcgacaagctg
ttcaaaaagctcggctggagcgccgacagcgtggacctgttcgagatcaacgaagcgttt
gccgtggtgccgatggcggccatgcacgacctgcgcatcccgcacgagaaggtgaacgtg
aacggcggcgcgtgtgcgctgggccacccgatcggcgcgtcgggcgcgcgcctgatcgcc
acgctgctgggcgcgctgcgccatcgcggcggcaagcgcggcgtggccagcctgtgcatc
ggcggcggcgaggccaccgcggtcggcatcgaactgctgtga

DBGET integrated database retrieval system