KEGG   Ralstonia solanacearum FQY_4: F504_4076Help
Entry
F504_4076         CDS       T02751                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00260  Glycine, serine and threonine metabolism
rse01100  Metabolic pathways
rse01110  Biosynthesis of secondary metabolites
rse01120  Microbial metabolism in diverse environments
rse01130  Biosynthesis of antibiotics
rse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F504_4076
Enzymes [BR:rse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     F504_4076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGH86587
UniProt: M4UMY9
Position
megaplasmid:complement(777545..778642)
Genome map
AA seq 365 aa AA seqDB search
MNRDPMPTTRTPALGFTSDNIEGASPEVLDAILAANAGQAAPYGADDCTARVEQTLSELF
EREVKVFLVPTGTAANALCLGAMTPPWGNVYCHPSSHINNDECGAPEFYTNGAKLVAVDG
PSAKIDVEKLRAATRVKVGDVHSTQPACVSLTQATEVGSLYTLNEIEAIGQLCKDARIKL
QMDGSRFANALVSLGCSPAAMTWKAGVDALSFGATKNGVVAAEAIVLFDLSLAAEMGYRR
KRAGHLFSKMRFLSAQIEAYLANDLWLRNARQANDMALRLARGLEGMHGASVLGATEANI
VFCRLPSTVIENLLQAGFRFYHDRWEPNVVRFVTSFATTADDVDNLLRHMKAAAAGPSAD
THATA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcgatccgatgccgaccaccagaacacccgccctgggctttaccagcgacaac
atcgaaggcgcgtcgcccgaggtgctcgatgccatccttgccgccaatgccggtcaggcg
gccccatacggcgcggatgactgcaccgcccgggtcgagcaaacgctgagcgagctgttc
gagcgcgaagtcaaagtcttcctggtcccgaccggcaccgcggccaatgcgctctgcctg
ggcgcgatgacgccgccctggggcaacgtgtactgccacccgtcaagccatatcaacaac
gacgagtgcggtgcccccgagttctatacgaacggcgcgaaactggtcgcagtggatggg
ccatccgccaagatcgatgtggagaagcttcgcgccgccacccgcgtgaaggtgggcgac
gtgcattccacccagcccgcttgcgtcagcctgacgcaagcgacggaagtcgggagcctc
tacacgctgaatgagatcgaagcgatcggacagctctgcaaggacgcccgcatcaagctg
cagatggatggctcgcgctttgccaacgcgctggtttccctgggctgctcgcccgcggca
atgacatggaaagcgggcgtcgatgcgctgtcgttcggcgcgaccaagaatggcgtcgtc
gctgcggaagccattgtgctgtttgacctgtcgctcgcggccgagatgggctaccgccgc
aagcgggccggccatctgttctcgaagatgcgctttctgtcggcccagatcgaagcctac
ctggccaacgatctctggttgcgcaacgcacgccaggcaaacgacatggccctgcgcctg
gcccgcggccttgaagggatgcatggggccagcgtgctgggcgccacggaagccaacatc
gtcttctgccgcctcccctcgaccgtcattgaaaacctgctccaggcgggattccgcttt
tatcacgatcgctgggagccgaacgtggtgcgctttgtgacgtccttcgccaccacggcc
gatgatgtcgacaacctgctgcggcatatgaaggccgcagccgccgggccatcggcagac
acccatgccaccgcatga

DBGET integrated database retrieval system