KEGG   Ralstonia solanacearum FQY_4: F504_4406Help
Entry
F504_4406         CDS       T02751                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00020  Citrate cycle (TCA cycle)
rse00620  Pyruvate metabolism
rse01100  Metabolic pathways
rse01110  Biosynthesis of secondary metabolites
rse01120  Microbial metabolism in diverse environments
rse01130  Biosynthesis of antibiotics
rse01200  Carbon metabolism
Module
rse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F504_4406
   00620 Pyruvate metabolism
    F504_4406
Enzymes [BR:rse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     F504_4406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AGH86916
UniProt: M4UMX4
Position
megaplasmid:complement(1182104..1183729)
Genome map
AA seq 541 aa AA seqDB search
MVCLAAFSAQAAETKKVDVLLVGGGIMSSTLGVWLHELEPDWSMMMVERLDGVAQESSNG
WNNAGTGHSALAELNYTPEKSNGKIDISKAVEINEGFQVTRQFWTYQVKTGVLKNPRSFI
NSTPHMSFVWGEDNVRYLKKRYEALQASPLFRGMQFSDDYDQISKWVPLMMEGRDRSQKV
AATWMPVGTDVNFGEITRQFVGYLQSQPQFTLSLSSEVRDIKRNDDGTWRVSYVNLKSGD
RQDVDTKFLFIGAGGGALRLLQASGIPEARDFAAFPVGGSFLVTENPEVVNRHLAKAYGK
ASVGSPPMSVPHLDTRVIDGKRIILFGPFATFSTKFLKNGSYMDLFGSTTSHNVMPMLHV
GVDEFPLVQYLAGQLMLSDEDRFNALKEYFPLAKKEDWRLWQAGQRVQIIQRDEAKGGIL
KLGTQIVKSKDGTIAGLLGASPGASTAAPIMLGVLETVFKDKLATPAWQQKVRQMIPTYG
IKLNDNPAKVYEEWVATAEALQLSPPPRIDLRVTPAAPAAKPAAGAAQQAKPAKATADIA
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtggtttgtctggcggcattttccgcgcaggccgccgagacgaagaaggtggatgtgctg
ctggtgggcggcggcatcatgagttcgacgctcggcgtctggctgcatgagctcgagccc
gactggtcgatgatgatggtcgagcgcctcgacggcgtcgcccaggaaagctcgaacggc
tggaacaacgccggcaccgggcactccgcgctggccgaactgaactacacccccgaaaaa
tcgaacggcaagatcgacatctccaaggccgtcgagatcaacgaaggcttccaggtaacg
cgccagttctggacgtaccaggtcaagaccggcgtgctcaagaacccgcgctcgttcatc
aattcgaccccgcacatgagcttcgtgtggggcgaggacaacgtccgctacctgaagaag
cgctacgaggcgctgcaggccagcccgctgttccgcggcatgcagttctcggacgactat
gaccagatcagcaagtgggtgccgctgatgatggaaggccgcgaccgctcgcagaaggtc
gccgccacctggatgccggtgggcaccgacgtgaacttcggcgagatcacgcgccagttc
gtcggctacctgcagagccagcctcagttcacgctgtcgctgtcgagcgaagtgcgcgac
atcaagcgcaatgacgacggcacgtggcgggtgtcgtacgtcaacctgaagtcgggcgac
cggcaggatgtcgacacgaagttcctcttcatcggcgcgggcggcggcgcattgcgcctg
ctgcaggcttcgggcattccggaagcgcgcgacttcgccgctttcccggtcggcggctcg
ttcctggtcaccgagaatccggaagtcgtgaaccgccacctggcgaaggcgtacggcaag
gcttcggtcggctcgccgccgatgtcggtgccgcacctggatacccgcgtcatcgacggc
aagcggatcatcctgttcggcccgttcgcgacgttctcgacgaagttcctgaagaacggt
tcgtacatggacctgttcggcagcaccacctcgcacaacgtcatgccgatgctgcacgtg
ggcgtcgacgagttcccgctggtccagtacctggcgggccagctgatgctgtccgacgaa
gaccgcttcaatgcgctgaaggaatacttcccgcttgcgaagaaggaagactggcgcctg
tggcaggccggccagcgcgtgcagatcatccagcgcgacgaggccaagggcggcatcctc
aagctcggcacgcagatcgtgaagtcgaaggacggcaccatcgccggcctgctcggcgca
tcgccgggcgcatcgaccgcggccccgatcatgctgggcgtgctcgagacggtgttcaag
gacaagctcgccacgccggcctggcagcagaaggtccgccagatgatcccgacctacggc
atcaagctcaacgacaacccggccaaggtctacgaggaatgggttgccaccgcggaagcg
ctgcagctgtcgccgccgccgcggatcgatctgcgcgtgacgcccgcggcgccggcagcg
aagccggcggctggggcggcccagcaggccaagccggccaaggccacggctgacatcgcg
ctgtaa

DBGET integrated database retrieval system