KEGG   Ralstonia solanacearum FQY_4: F504_4450
Entry
F504_4450         CDS       T02751                                 

Gene name
vgrG
Definition
(GenBank) VgrG protein
Organism
rse  Ralstonia solanacearum FQY_4
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: AGH86960
UniProt: M4V2S4
Position
megaplasmid:complement(1235965..1238985)
AA seq 1006 aa
MDVTTLLQNLFAPAHRLYALEGEGPIAELAVEAWLGREALSELFEWRVVAASANARIALE
SFIGQRVTLVTTLADGTQARRTGLIRQAEQLGADGSLARYRLTVVPWFWLATQQRHSQVF
QNRPLADILEQMLSPYAPYAAWRFAAGAEDRMAAFGTRTHIAQFRETDYRFVTRLLAEAG
LGFTTVEDEQAPSGHALLIFADSSRLAEDTASAAEGGIRYHRAHSQEECDAIQALICHSR
TAVGGVAVAAWDAQAKRAFRAHVPSRFCGIAGSPDAYLSISPSLAPDTANAQRIAEQVME
SVEARARLFIGRGSVRTLRSGTRLKIVDCPHLPKDVDGPYPLLIDLVEHCGINNLTADTQ
ATLARKLGGLDVALTFDTPPSPPESGPGPFGFMAPHEVIERFTPTADLLTAARAHGYAGQ
FRASDARRPWRPVVSHPDTGRLYAEPTARGVQSAIVVGPNGETEASGDAEHHTTPRGQVR
VRFPWQQGERPDDRSTGWLLVAQRQAGAGMGWQWLPRIGQEVLVKFQEDDIDQPVVIGAL
YNGQGEAGIAPTPGGQVAKGVRQEADPETLYRLGSDSAASAQGNLAAGHSPAWHGLGTEA
EGHRNAAALSGFKSAEHGGRGANLLVFDDSDGQLRTQLATTQAHSQLNLGHLIHQQDNRR
GSFRGQGFELRTDGYGAVRGQAGVLLTTYRDATSGKAVPTGDNAAGIALIRQAKQLTASL
SQGATTHQTAALSTAKDDSAPLAKQEKAASGMVDGKALDAAQQDAAAGNTATQGKVPHQS
EATVQLAGRAGLVAIAGQDLQFANGESVVLASGQDTNVAVGKQARIHAGQGIGVAAGLSK
AGDDDIGLQLTAGQDNLDVQAQHDALGLLSKDDLKLVSANLHVDFAAAKRIRLATAAGAS
ITLEGGNIIVETPGRITYKAAQRSFAGPTHASRDMNTWSHSAFDDRYVLRDQVTHEPLRN
TQVELRRGDGAVLKLVTDGEGRLPVQKGISMERVQLRVLGKLSGKT
NT seq 3021 nt   +upstreamnt  +downstreamnt
atggacgtaacgacccttctccagaacctcttcgctcccgcgcaccgcctgtacgcgctg
gaaggcgaaggcccgatcgcggaactggcggtggaggcatggctcggccgcgaggccttg
tccgagctgttcgaatggcgggtggtggccgccagcgccaatgcgcgcatcgcgctcgaa
tcgttcatcggccagcgcgtgacgctggtcaccacgctggccgacggcacgcaggcccgg
cgcaccggcctgatccggcaggccgagcagctcggcgccgatggcagcctggcgcgctat
cgcctgaccgtggtgccgtggttctggctcgccacccaacagcggcacagccaggtgttc
cagaaccggccgctggcggacatcctcgaacagatgctgtcgccgtatgcgccctatgcc
gcatggcgcttcgccgctggcgcggaagaccgcatggcggcgttcggcacgcgcacgcac
atcgcccagttccgagagaccgactaccgcttcgtcacgcgcctgctggccgaggcgggt
ctgggcttcaccaccgtcgaggatgagcaggcgcccagcggccacgcgctgctgatcttt
gccgacagcagccggctggccgaggacacggcatccgctgccgagggtggcatccgctac
caccgcgcgcacagccaggaagagtgcgacgcgatccaggcgttgatctgccatagccgc
acagcggtcggcggagtggcggtggcggcctgggatgcgcaggccaagcgggccttccgc
gcgcacgttccctctcggttttgcggtatcgcgggcagcccggatgcctatctgtcgatc
agcccgtcgctggcgccggatacggccaacgcgcagcgcatcgccgagcaggtgatggag
agcgtcgaagcgcgcgctcgcctgttcatcggacgcggctcggtgcgcacgctgcgcagc
ggcacgcgactgaagatcgtggactgcccgcacctgccgaaggacgtggacggcccgtat
ccgttgctgatcgacctggtggagcactgcggcatcaacaacctgaccgccgatacgcag
gcaacattggcccggaagctgggcgggctcgacgtcgcactgaccttcgacacgccgccc
agcccacccgaatccggcccgggcccgttcggtttcatggcgccacacgaggtcatcgaa
cgcttcacgccgacggcggacctgctcaccgctgcgcgcgcccacggctacgccggccaa
ttccgcgcgagcgacgcacgccgcccgtggcgaccggtcgtgtcacaccccgacaccggc
cgcctgtacgccgagcccaccgccaggggcgtgcagagcgccatcgtggtcggcccgaac
ggcgagaccgaggccagtggcgatgcggagcaccacaccactccacggggccaggtccgt
gtccgcttcccgtggcagcagggcgaacgtccggatgaccgcagcaccggctggctgctg
gtcgcgcagcggcaggctggggccggcatgggctggcagtggctgccgcgcatcggccag
gaggtgctggtcaagttccaggaagacgacatcgaccagccggtggtgatcggcgcgctc
tacaacggccagggcgaagcgggtatcgcgccgacccctggcgggcaggtcgccaagggt
gtcaggcaggaggccgacccggagaccctctaccgtttgggcagcgacagcgccgccagc
gcgcagggcaacctcgccgccggccacagccccgcatggcacggcctgggcaccgaggcc
gaaggccaccgcaacgccgccgccctcagcggcttcaagagcgccgagcatggcgggcgc
ggcgccaacctgctcgtcttcgacgacagcgacgggcagttgcgtacgcagttggccacc
acgcaggcccacagccaactgaacctgggccacctgatccaccagcaggacaaccggcgc
ggcagcttccggggccagggcttcgagctgcgcaccgatggctatggcgcggtgcgcggc
caggccggtgtgctgctgaccacctaccgcgatgccacgagcggcaaggctgtgccgacc
ggcgacaacgccgccggcatcgcgctgatccggcaggccaaacagctcaccgcatcgttg
agccagggcgccaccacgcatcagacggccgcgctgtccaccgccaaggacgacagtgcg
ccgctcgccaagcaagagaaggccgcctccggcatggtggacggcaaagcgctcgacgcc
gcccagcaggatgcggccgcaggcaacaccgccacgcaaggcaaggtgccgcatcaaagc
gaagcgacggtgcagctggccggccgcgcgggcctggtggcgatcgccgggcaggatctg
caattcgccaacggcgagagcgttgtgctggccagcggccaggacaccaacgtcgcggtg
ggcaagcaggcgcgcatccacgcggggcagggcatcggcgtggcggcggggctgtcgaag
gcgggggacgacgacatcgggctgcaactgacagcggggcaggacaacctcgacgtgcag
gcgcagcatgacgcgctcgggctgctgtccaaggacgacctgaagctggtgtcggcgaat
ctgcatgtggacttcgcggcggccaagcggatccggctggcgacggcggcgggggcgtcg
atcacgctggagggcgggaacatcatcgtcgagacgccggggcggattacgtacaaggcg
gcgcagcgcagctttgcggggcccacgcacgcgtcgcgcgatatgaacacgtggtcgcac
agtgcgtttgacgatcgatatgttttgcgcgaccaggtcacgcacgagccgctgcggaat
acgcaggtcgagttgcggcgtggtgacggtgcggtactcaagctggtcaccgatggagag
ggccgcctccctgtgcagaaaggtatttccatggagcgcgtgcaactgcgcgtgctggga
aagctctccggcaaaacctaa

DBGET integrated database retrieval system