KEGG   Ralstonia solanacearum FQY_4: F504_4476
Entry
F504_4476         CDS       T02751                                 

Definition
(GenBank) Hypothetical Protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    F504_4476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rse02044]
    F504_4476
Secretion system [BR:rse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   F504_4476
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGH86985
UniProt: M4V2U4
Position
megaplasmid:complement(1273086..1273589)
AA seq 167 aa
MKDIYVKFDSPAIKGESQDKDHKEWIEVNSWSQSIIQPRSATASTAGGHTAERCEHRDMV
FSKDLDVVSPLLYQHASGGTTFGEVTIEFFRADGEGNRVKYLEVKLKNAILSEVDSQVAA
EGIPTDTFSLRYAAVQWKYTQQKSAGGQGGNSQGAWSLTKNDKTYSV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaggatatctacgtcaagttcgacagcccggccatcaagggggagtcccaggacaag
gatcacaaggagtggatcgaagtcaacagctggtcccagtcgatcatccagccgcgttcg
gccacggcctcgaccgcgggcggccataccgccgagcgttgcgagcaccgcgacatggtg
ttctccaaggacctggacgtggtcagcccgctgctgtaccagcacgcttcgggcggcacg
accttcggtgaagtgacgatcgagttcttccgcgccgacggtgaaggcaaccgcgtgaag
tacctcgaggtcaagctgaagaacgcgatcctgagcgaagtggattcgcaggtggctgcc
gagggcatcccgaccgatacgttcagcctgcgctacgcggccgtgcagtggaagtacacc
cagcagaagagcgccggtggccagggcggcaactcgcagggcgcctggagcctgaccaag
aacgacaagacctactcggtttaa

DBGET integrated database retrieval system