KEGG   Ralstonia solanacearum FQY_4: F504_4478
Entry
F504_4478         CDS       T02751                                 

Gene name
impB
Definition
(GenBank) Uncharacterized protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
rse  Ralstonia solanacearum FQY_4
Brite
KEGG Orthology (KO) [BR:rse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rse02044]
    F504_4478 (impB)
Secretion system [BR:rse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   F504_4478 (impB)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AGH86987
UniProt: M4UP68
Position
megaplasmid:complement(1275161..1275673)
AA seq 170 aa
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLSGQSEVAQPKLRDR
KFVNIDRDNFDDVMSAAEPRAAFQVQNTLTEEGGRFGVDLKFRSLEDFSPEAVVNQIEPL
RQLLEARSKLADLRNKLAGNDKLEDLLSEVLNNTEALQKLGVKMDGGEDA
NT seq 513 nt   +upstreamnt  +downstreamnt
atggccaagaaagaaagtgtgcagaagcgtctgcagaaggtgcgccccccgcgcgtgcag
ctgacgtacgacgttgaaaagggcgacgcgatcgagcagaaggaactgccgttcgtggtc
ggcgtggtggcggacctgtcgggccagtcggaagtggcgcagcccaagctgcgcgaccgc
aagttcgtcaacatcgaccgcgacaacttcgacgacgtgatgtcggcggccgagccgcgc
gctgcctttcaggtgcagaacacgctgacggaagagggcggccgcttcggcgtcgacctc
aagttccgctcgctggaggatttctcgccggaagccgtggtgaaccagatcgagccgctg
cgccagctgctggaggcacgctccaagctggccgacctgcgcaacaagctggccggcaac
gataagctggaagacctgctgtccgaggtgctgaacaacaccgaggccctgcagaagctg
ggtgtcaagatggatgggggtgaggatgcttga

DBGET integrated database retrieval system