KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0022Help
Entry
Rsph17029_0022    CDS       T00484                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00071  Fatty acid degradation
rsh00072  Synthesis and degradation of ketone bodies
rsh00280  Valine, leucine and isoleucine degradation
rsh00310  Lysine degradation
rsh00362  Benzoate degradation
rsh00380  Tryptophan metabolism
rsh00620  Pyruvate metabolism
rsh00630  Glyoxylate and dicarboxylate metabolism
rsh00640  Propanoate metabolism
rsh00650  Butanoate metabolism
rsh00900  Terpenoid backbone biosynthesis
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
rsh01120  Microbial metabolism in diverse environments
rsh01130  Biosynthesis of antibiotics
rsh01200  Carbon metabolism
rsh01212  Fatty acid metabolism
rsh02020  Two-component system
Module
rsh_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rsph17029_0022
   00630 Glyoxylate and dicarboxylate metabolism
    Rsph17029_0022
   00640 Propanoate metabolism
    Rsph17029_0022
   00650 Butanoate metabolism
    Rsph17029_0022
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rsph17029_0022
   00072 Synthesis and degradation of ketone bodies
    Rsph17029_0022
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rsph17029_0022
   00310 Lysine degradation
    Rsph17029_0022
   00380 Tryptophan metabolism
    Rsph17029_0022
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rsph17029_0022
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rsph17029_0022
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rsph17029_0022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsh04147]
    Rsph17029_0022
Enzymes [BR:rsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rsph17029_0022
Exosome [BR:rsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17029_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABN75142
UniProt: A3PFM6
Position
1:23980..25182
Genome map
AA seq 400 aa AA seqDB search
MVRPSREKGRAMSDILVLSAVRTAIGGFGGALAAVPPGDLATTVTRAALERAGVEPGRVG
HVVFGHVINTEPRDMYLSRVAAMQAGIPSEVPAMNVNRLCGSGVQAIVSAMQALMLGDAE
VALAGGAESMSRAPYALTTARWGQKMGDTRALDMMTGALNCPFGTGHMGITAEIVAERHG
ISREDQDAFALESQTRTARAQEEGRFDGQIVPVEIASRKGPVSFSRDEHPKATTLEALAG
LRPAFQKGGTVTAGNASGINDGAGALILAREGAVPGARPLGRLIGYAHAGVDPEVMGLGP
IPAVQALCARTGLSVADFDVIESNEAFAAQALAVARALDFDPARVNPNGGAIALGHPVGA
TGAIITVKALHELHRTGGRRALVTMCIGGGQGIALALERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggccatccagagagaaaggccgcgccatgtccgacatcctcgtcctctccgcc
gtccgcaccgccatcggcggcttcggcggcgcgctcgccgcggtcccgccgggcgatctc
gccaccaccgtcacccgcgccgcgctggagcgcgcgggcgtggagcccggccgcgtcggt
catgtggtcttcggccatgtcatcaacaccgaaccgcgcgacatgtatctctcgcgcgtg
gcggcgatgcaggcgggcatcccgtcggaggtgccggcgatgaacgtgaaccggctctgc
ggctcgggcgtgcaggccatcgtctcagccatgcaggcgctgatgctgggcgatgccgag
gtggcgctggcgggcggcgcggaatcgatgagccgcgcgccctatgcgctgacgacggcg
cggtggggccagaagatgggcgacacgcgcgcgctcgacatgatgacgggggcgctcaac
tgccccttcggcaccggccacatgggcatcaccgccgagatcgtggccgagcgccacggc
atcagccgcgaggatcaggacgcgttcgcgctggaaagccagacccgcaccgcccgcgcg
caggaggagggccgcttcgacggccagatcgttcctgtcgagatcgcctcgcggaagggg
ccggtctccttctcccgcgacgaacatcccaaggccaccaccctcgaggcgctcgcgggg
ctgcgtcccgccttccagaaaggcggcaccgtgaccgcgggcaatgcgagcgggatcaac
gacggggccggggcgttgatcctcgcgcgcgagggggccgtgcccggcgcgcgtccgctc
ggccggctgatcggctatgcccatgcgggcgtcgatcccgaggtgatggggctggggccg
atcccggcggtgcaggcgctctgtgcgcgcaccggcctctcggtcgcggatttcgacgtg
atcgagtcgaacgaggccttcgcggcgcaggcgctggccgtggcgcgcgcgctcgatttc
gatccggccagggtgaacccgaacggcggcgccatcgcgctcggccatccggtcggcgcg
acgggggcgatcatcacggtgaaggcgctccacgagctgcaccggacgggcgggcgccgc
gccctcgtcaccatgtgcatcggcggcgggcaggggatcgcgctggcgctcgagcgggtc
tga

DBGET integrated database retrieval system