KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1025Help
Entry
Rsph17029_1025    CDS       T00484                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00051  Fructose and mannose metabolism
rsh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rsph17029_1025
Enzymes [BR:rsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Rsph17029_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABN76136
UniProt: A3PIH0
Position
1:1057846..1058502
Genome map
AA seq 218 aa AA seqDB search
MNEMSDLSDLAKREEIIRQCLEMNRSGLNQGTSGNISVRHGEGMLITPTSLPYDTLVPED
IVFVSMEGEVRGRHKPSSEWRFHRDILRERADVNAVVHAHPTYCTTLAIMNREIPSIHYM
LAVVGGPNIRCAPYAIYGSEELSRNAVEALRDRKACLLEHHGMIAVGKSLAQAMWLAVEV
ETLARQYHGCLQIGEPRLLSERQIQDVIDKIAGYGHQG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgagcgatctgtccgacctcgccaagcgcgaagagatcatccgccagtgt
ctcgagatgaaccgctcgggcctcaatcagggcacctcgggcaacatctcggtgcgccac
ggcgaggggatgctgatcacccccacgtcgctgccctacgacacgctggttcccgaggac
atcgtcttcgtctcgatggagggcgaggtgcggggccggcacaagccgtcgagcgaatgg
cgcttccaccgcgacatcctgcgcgagcgggcggacgtgaatgcggtggtgcatgcgcat
ccgacctactgcaccacgctcgccatcatgaaccgcgagatcccctcgatccactacatg
ctggcggtggtgggcggcccgaacatccgctgcgcgccctacgcgatctacggttcggag
gagctgtcgcggaacgcggtcgaggcgctgcgcgaccgcaaggcctgccttctcgaacat
cacggcatgatcgccgtgggcaagagcctcgcgcaggccatgtggctcgccgtcgaggtc
gagacgctggcccggcagtatcacggctgccttcagatcggcgagccgcggctgctgagc
gagcggcagatccaggacgtgatcgacaagatcgccggctacggccaccagggctga

DBGET integrated database retrieval system